CDCA4 Antibody

Images

 
Immunohistochemistry-Paraffin: CDCA4 Antibody [NBP2-32457] - Staining of human lymph node shows cytoplasmic positivity in macrophages.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDCA4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDCA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDCA4 Protein (NBP2-32457PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDCA4 Antibody

  • cell division cycle associated 4
  • cell division cycle-associated protein 4
  • FLJ20764
  • FLJ52878
  • Hematopoietic progenitor protein
  • Hepp
  • HEPPMGC19517
  • SEI-3/HEPP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31052
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81541
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16216
Species: Hu, Mu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84217
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDCA4 Antibody (NBP2-32457) (0)

There are no publications for CDCA4 Antibody (NBP2-32457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDCA4 Antibody (NBP2-32457) (0)

There are no reviews for CDCA4 Antibody (NBP2-32457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDCA4 Antibody (NBP2-32457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDCA4 Products

Bioinformatics Tool for CDCA4 Antibody (NBP2-32457)

Discover related pathways, diseases and genes to CDCA4 Antibody (NBP2-32457). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDCA4 Antibody (NBP2-32457)

Discover more about diseases related to CDCA4 Antibody (NBP2-32457).
 

Pathways for CDCA4 Antibody (NBP2-32457)

View related products by pathway.

PTMs for CDCA4 Antibody (NBP2-32457)

Learn more about PTMs related to CDCA4 Antibody (NBP2-32457).

Blogs on CDCA4

There are no specific blogs for CDCA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDCA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDCA4