SERTAD4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SERTAD4 Antibody [NBP1-84216] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SERTAD4 Antibody [NBP1-84216] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: SERTAD4 Antibody [NBP1-84216] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SERTAD4 Antibody [NBP1-84216] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SERTAD4 Antibody [NBP1-84216] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SERTAD4 Antibody [NBP1-84216] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SERTAD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLKFIDDPEVYLRRSVLINNLMKRIHGEIIMQNNWCFPACSFNGTSAQEWFMAQDCPYRKRPRMAKEEC
Specificity
Specificity of human SERTAD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERTAD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SERTAD4 Protein (NBP1-84216PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SERTAD4 Antibody

  • DJ667H12.2
  • SERTA domain containing 4
  • SERTA domain-containing protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32457
Species: Hu
Applications: IHC, IHC-P
NBP2-14225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31052
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-81541
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-66307
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for SERTAD4 Antibody (NBP1-84216) (0)

There are no publications for SERTAD4 Antibody (NBP1-84216).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERTAD4 Antibody (NBP1-84216) (0)

There are no reviews for SERTAD4 Antibody (NBP1-84216). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SERTAD4 Antibody (NBP1-84216) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SERTAD4 Antibody (NBP1-84216)

Discover related pathways, diseases and genes to SERTAD4 Antibody (NBP1-84216). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERTAD4 Antibody (NBP1-84216)

Discover more about diseases related to SERTAD4 Antibody (NBP1-84216).
 

Pathways for SERTAD4 Antibody (NBP1-84216)

View related products by pathway.

Blogs on SERTAD4

There are no specific blogs for SERTAD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERTAD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERTAD4