| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CDCA2 Antibody - BSA Free (NBP1-87140) is a polyclonal antibody validated for use in WB, ICC/IF and IP. Anti-CDCA2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDCA2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-87140 | Applications | Species |
|---|---|---|
| Junbin Qian, Monique Beullens, Jin Huang et al. Cdk1 orders mitotic events through coordination of a chromosome-associated phosphatase switch. Nature Communications 2015-01-01 [PMID: 26674376] (IP, WB, ICC/IF, Human) | IP, WB, ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CDCA2 Antibody (NBP1-87140)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDCA2 |