CDC42EP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CDC42EP1 Antibody [NBP1-88379] - Staining of human cell line A-431 shows localization to plasma membrane & actin filaments.
Immunohistochemistry-Paraffin: CDC42EP1 Antibody [NBP1-88379] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC42EP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42EP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDC42EP1 Protein (NBP1-88379PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC42EP1 Antibody

  • Binder of Rho GTPases 5
  • Borg5
  • BORG5cdc42 effector protein 1
  • CDC42 effector protein (Rho GTPase binding) 1
  • CEP155 kDa bone marrow stromal/endothelial cell protein
  • MSE55MGC15316
  • serum constituent protein
  • Serum protein MSE55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88380
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88382
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88383
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91773
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
H00023433-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-48546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP

Publications for CDC42EP1 Antibody (NBP1-88379) (0)

There are no publications for CDC42EP1 Antibody (NBP1-88379).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42EP1 Antibody (NBP1-88379) (0)

There are no reviews for CDC42EP1 Antibody (NBP1-88379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDC42EP1 Antibody (NBP1-88379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC42EP1 Products

Bioinformatics Tool for CDC42EP1 Antibody (NBP1-88379)

Discover related pathways, diseases and genes to CDC42EP1 Antibody (NBP1-88379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42EP1 Antibody (NBP1-88379)

Discover more about diseases related to CDC42EP1 Antibody (NBP1-88379).
 

Pathways for CDC42EP1 Antibody (NBP1-88379)

View related products by pathway.

PTMs for CDC42EP1 Antibody (NBP1-88379)

Learn more about PTMs related to CDC42EP1 Antibody (NBP1-88379).

Blogs on CDC42EP1

There are no specific blogs for CDC42EP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42EP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42EP1