CDC42EP2 Antibody


Western Blot: CDC42EP2 Antibody [NBP1-88383] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunocytochemistry/ Immunofluorescence: CDC42EP2 Antibody [NBP1-88383] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: CDC42EP2 Antibody [NBP1-88383] - Staining of human stomach shows string cytoplasmic and membrane positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CDC42EP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQI
Specificity of human CDC42EP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDC42EP2 Protein (NBP1-88383PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDC42EP2 Antibody

  • BORG1CEP2Binder of Rho GTPases 1
  • CDC42 effector protein (Rho GTPase binding) 2
  • cdc42 effector protein 2
  • CRIB-containing BOGR1 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDC42EP2 Antibody (NBP1-88383) (0)

There are no publications for CDC42EP2 Antibody (NBP1-88383).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42EP2 Antibody (NBP1-88383) (0)

There are no reviews for CDC42EP2 Antibody (NBP1-88383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDC42EP2 Antibody (NBP1-88383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDC42EP2 Products

Bioinformatics Tool for CDC42EP2 Antibody (NBP1-88383)

Discover related pathways, diseases and genes to CDC42EP2 Antibody (NBP1-88383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42EP2 Antibody (NBP1-88383)

Discover more about diseases related to CDC42EP2 Antibody (NBP1-88383).

Pathways for CDC42EP2 Antibody (NBP1-88383)

View related products by pathway.

Blogs on CDC42EP2

There are no specific blogs for CDC42EP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDC42EP2 Antibody and receive a gift card or discount.


Gene Symbol CDC42EP2