CDC42 Antibody

Western Blot: CDC42 Antibody [H00000998-D01P] - Analysis of CDC42 expression in transfected 293T cell line by CDC42 polyclonal antibody.Lane 1: CDC42 transfected lysate(21.30 KDa).Lane 2: Non-transfected lysate.

Proximity Ligation Assay: CDC42 Antibody [H00000998-D01P] - Analysis of protein-protein interactions between CDC42 and MAPK8. HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-MAPK8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Discontinued

CDC42 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CDC42 (NP_001782.1, 1 a.a. - 191 a.a.) full-length human protein. MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
• Specificity: Reacts with cell division cycle 42 (GTP binding protein, 25kDa).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC42
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC42 Antibody

• CDC42
• CDC42Hs
• cell division control protein 42 homolog
• cell division cycle 42 (GTP binding protein, 25kDa)
• cell division cycle 42 (GTP-binding protein, 25kD)
• dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))
• dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD))
• G25K GTP-binding protein
• G25K
• growth-regulating protein
• GTP-binding protein, 25kD
• small GTP binding protein CDC42

Background

The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC42
• Entrez:
  • 998(Human)
• Uniprot:
  • NP_001782.1(Human)