CDC42 Antibody

Images

 
Western Blot: CDC42 Antibody [H00000998-D01P] - Analysis of CDC42 expression in transfected 293T cell line by CDC42 polyclonal antibody.Lane 1: CDC42 transfected lysate(21.30 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: CDC42 Antibody [H00000998-D01P] - Analysis of protein-protein interactions between CDC42 and MAPK8. HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-MAPK8 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC42 Antibody Summary

Immunogen
CDC42 (NP_001782.1, 1 a.a. - 191 a.a.) full-length human protein. MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Specificity
Reacts with cell division cycle 42 (GTP binding protein, 25kDa).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC42 Antibody

  • CDC42
  • CDC42Hs
  • cell division control protein 42 homolog
  • cell division cycle 42 (GTP binding protein, 25kDa)
  • cell division cycle 42 (GTP-binding protein, 25kD)
  • dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))
  • dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD))
  • G25K GTP-binding protein
  • G25K
  • growth-regulating protein
  • GTP-binding protein, 25kD
  • small GTP binding protein CDC42

Background

The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
AF6260
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for CDC42 Antibody (H00000998-D01P) (0)

There are no publications for CDC42 Antibody (H00000998-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42 Antibody (H00000998-D01P) (0)

There are no reviews for CDC42 Antibody (H00000998-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC42 Antibody (H00000998-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC42 Products

Bioinformatics Tool for CDC42 Antibody (H00000998-D01P)

Discover related pathways, diseases and genes to CDC42 Antibody (H00000998-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42 Antibody (H00000998-D01P)

Discover more about diseases related to CDC42 Antibody (H00000998-D01P).
 

Pathways for CDC42 Antibody (H00000998-D01P)

View related products by pathway.

PTMs for CDC42 Antibody (H00000998-D01P)

Learn more about PTMs related to CDC42 Antibody (H00000998-D01P).

Blogs on CDC42

There are no specific blogs for CDC42, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42
Entrez
Uniprot