Home » CDC42 » CDC42 Antibodies » CDC42 Antibody

CDC42 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CDC42 Antibody [H00000998-D01P] - Analysis of CDC42 expression in transfected 293T cell line by CDC42 polyclonal antibody.Lane 1: CDC42 transfected lysate(21.30 KDa).Lane 2: Non-transfected lysate.
Western Blot: CDC42 Antibody [H00000998-D01P] - Analysis of CDC42 expression in transfected 293T cell line by CDC42 polyclonal antibody.Lane 1: CDC42 transfected lysate(21.30 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: CDC42 Antibody [H00000998-D01P] - Analysis of protein-protein interactions between CDC42 and MAPK8. HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-MAPK8 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CDC42 Antibody Summary

Immunogen
CDC42 (NP_001782.1, 1 a.a. - 191 a.a.) full-length human protein. MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Specificity
Reacts with cell division cycle 42 (GTP binding protein, 25kDa).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.
Positive Control
CDC42 Lysate (NBP2-65820)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC42 Antibody

  • CDC42
  • CDC42Hs
  • cell division control protein 42 homolog
  • cell division cycle 42 (GTP binding protein, 25kDa)
  • cell division cycle 42 (GTP-binding protein, 25kD)
  • dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))
  • dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD))
  • G25K GTP-binding protein
  • G25K
  • growth-regulating protein
  • GTP-binding protein, 25kD
  • small GTP binding protein CDC42

Background

The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Rac1 Antibody
NB100-91266
Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NB100-91266] - Mouse Brain (cerebral cortex), Image is courtesy of customer review.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunocytochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord using Rabbit antibody to RAC1, RAC2 (100-150) at 1 : 1000 dilution. Pre-absorption of the antibody with the immunising peptide completely abolishes the immunostaining (not shown).
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
RhoD Antibody
(OTI2F7)
NBP2-01462
Western Blot: RhoD Antibody (2F7) [NBP2-01462] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RhoD (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RhoD.
Immunocytochemistry/Immunofluorescence: RhoD Antibody (2F7) [NBP2-01462] Staining of COS7 cells transiently transfected by pCMV6-ENTRY RhoD.
Flow Cytometry: RhoD Antibody (2F7) [NBP2-01462] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RhoD antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, ICC/IF
Rhodopsin Antibody
(A531)
NBP2-25159
Western Blot: Rhodopsin Antibody (A531) [NBP2-25159] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important not to boil a sample containing it in SDS-PAGE sample buffer, as this will result in more extensive aggregation of the Rhodopsin protein.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (A531) [NBP2-25159] - Pig retinal section stained with NBP2-25159 (green) and counterstained with rabbit polyclonal antibody to NF-M NB300-133 (red) and DNA (blue). Rhodopsin is most abundant in the outer segments of retina (OS), NF-M is abundant in the optic nerve fiber layer (ONFL), but seen in processes and neurons in other regions also. Other layers are pigmented epithelium (PE), outer and inner nuclear layers (ONL, INL), outer and inner plexiform layers (OPL, IPL) and ganglion cell layer (GCL).
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
RhoA Antibody
NB100-91273
Western Blot: RhoA Antibody [NB100-91273] - Rat spinal cord lysate using Rabbit antibody to Transforming protein RhoA: whole serum at 1:2000 dilution. One single band is detected.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin sections) using Rabbit antibody to RhoA at a concentration of 15 ug/ml, incubated overnight and developed with DAB Ni.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
WASP [p Ser483, p
Ser484] Antibody
NB100-2307
Western Blot: WASP [p Ser483, p Ser484] Antibody [NB100-2307] - Detection of Human Phospho WASP (S483/S484) by Western Blot. Samples: Whole cell lysate (50 ug) from Jurkat and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Phospho WASP (S483/S484) antibody NB100-2307 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: WASP [p Ser483, p Ser484] Antibody [NB100-2307] - Whole cell lysate (50 ug/lane) from U937 and Jurkat cells. Lysates were either untreated, mock treated with phosphatase or treated with phosphatase. Antibody used at 1 ug/ml.
(6 Publications)
Species: Hu
Applications: WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC
RASGRF1 Antibody
NBP1-85727
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SOS1 Antibody
(SOS-01)
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: WB, ICC/IF
PKN1 Antibody
NB100-56159
PKN1 Antibody
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - ACTR2 monoclonal antibody (M01), clone 1B10-C4 Analysis of ACTR2 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Analysis of monoclonal antibody to ACTR2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Western Blot: ACTR2 Antibody (1B10-C4) [H00010097-M01] - Western Blot analysis of ACTR2 expression in A-431 ( Cat # L015V1 ).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
PAK1 Antibody
NBP1-85802
Western Blot: PAK1 Antibody [NBP1-85802] - Analysis in human cell lines U2OS and MCF-7 using Anti-PAK1 antibody. Corresponding PAK1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: PAK1 Antibody [NBP1-85802] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: PAK1 Antibody [NBP1-85802] - Staining in human cerebral cortex and pancreas tissues using anti-PAK1 antibody. Corresponding PAK1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - Immunoprecipitation of GEF-H1 protein from 293T whole cell extracts using 5 ug of GEF-H1 antibody. Western blot analysis was performed using GEF-H1 antibody. EasyBlot anti-Rabbit IgG was used as a secondary reagent.
Immunocytochemistry/Immunofluorescence: GEF-H1 Antibody [NBP2-21577] - HeLa cells were fixed in -20C 100% MeOH for 5 min. Green: ARHGEF2 protein stained by GEF-H1 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: GEF-H1 Antibody [NBP2-21577] - Paraffin-embedded mouse testis. GEF-H1 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.
Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF
N-WASP Antibody
NBP1-82512
Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: N-WASP Antibody [NBP1-82512] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining in human cerebral cortex and skeletal muscle tissues. Corresponding WASL RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
IQGAP1 Antibody
NBP1-06529
Western Blot: IQGAP1 Antibody [NBP1-06529] - Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 ug) cells. NBP1- 06529 antibody used for WB at 0.04 ug/ml (A) and 0.4 ug/ml (B) and used for IP at 3 ug/mg lysate.
Immunohistochemistry-Paraffin: IQGAP1 Antibody [NBP1-06529] - FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-IQGAP1 used at a dilution of 1:200 (1ug/ml). Detection: DAB
Proximity Ligation Assay: IQGAP1 Antibody [NBP1-06529] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human MEN1 (NB100-287) and rabbit anti-human IQGAP1 (NBP1-06529). Image merged from DAPI (2ms) and Texas Red (200ms) exposures, 40X mangification.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IHC-P, IP, PLA
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC

Publications for CDC42 Antibody (H00000998-D01P) (0)

There are no publications for CDC42 Antibody (H00000998-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42 Antibody (H00000998-D01P) (0)

There are no reviews for CDC42 Antibody (H00000998-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC42 Antibody (H00000998-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

CDC42 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional CDC42 Products

Bioinformatics Tool for CDC42 Antibody (H00000998-D01P)

Discover related pathways, diseases and genes to CDC42 Antibody (H00000998-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42 Antibody (H00000998-D01P)

Discover more about diseases related to CDC42 Antibody (H00000998-D01P).
 

Pathways for CDC42 Antibody (H00000998-D01P)

View related products by pathway.

PTMs for CDC42 Antibody (H00000998-D01P)

Learn more about PTMs related to CDC42 Antibody (H00000998-D01P).

Blogs on CDC42

There are no specific blogs for CDC42, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CDC42
Entrez
Uniprot