CDC25C Recombinant Protein Antigen

Images

 
There are currently no images for CDC25C Recombinant Protein Antigen (NBP2-57705PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDC25C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC25C.

Source: E. coli

Amino Acid Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC25C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57705.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC25C Recombinant Protein Antigen

  • CDC 25
  • CDC25
  • CDC25C
  • cell division cycle 25 homolog C (S. cerevisiae)
  • cell division cycle 25 homolog C (S. pombe)
  • cell division cycle 25C
  • Dual specificity phosphatase Cdc25C
  • EC 3.1.3.48
  • mitosis inducer CDC25
  • M-phase inducer phosphatase 3
  • phosphotyrosine phosphatase

Background

Cdc25C is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP3-13291
Species: Mu, Rt
Applications: WB
MAB1648
Species: Hu, Mu, Rt
Applications: IHC, WB
AF1649
Species: Hu, Mu, Rt
Applications: ICC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-33506
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-57705PEP
Species: Hu
Applications: AC

Publications for CDC25C Recombinant Protein Antigen (NBP2-57705PEP) (0)

There are no publications for CDC25C Recombinant Protein Antigen (NBP2-57705PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC25C Recombinant Protein Antigen (NBP2-57705PEP) (0)

There are no reviews for CDC25C Recombinant Protein Antigen (NBP2-57705PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC25C Recombinant Protein Antigen (NBP2-57705PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC25C Products

Research Areas for CDC25C Recombinant Protein Antigen (NBP2-57705PEP)

Find related products by research area.

Blogs on CDC25C

There are no specific blogs for CDC25C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC25C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC25C