Cdc20 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cdc20 Antibody [NBP2-58408] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cdc20 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGK
Specificity
Specificity of human Cdc20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC20
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cdc20 Recombinant Protein Antigen (NBP2-58408PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Cdc20 Antibody

  • CDC20 cell division cycle 20 homolog (S. cerevisiae)
  • CDC20 cell division cycle 20 homolog
  • cell division cycle 20 homolog (S. cerevisiae)
  • cell division cycle protein 20 homolog
  • MGC102824
  • p55CDCS. cerevisiae, homolog)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-88626
Species: Hu
Applications: IHC, IHC-P
NBP2-44687
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP2-75659
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-58408
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for Cdc20 Antibody (NBP2-58408) (0)

There are no publications for Cdc20 Antibody (NBP2-58408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc20 Antibody (NBP2-58408) (0)

There are no reviews for Cdc20 Antibody (NBP2-58408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cdc20 Antibody (NBP2-58408) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cdc20 Products

Bioinformatics Tool for Cdc20 Antibody (NBP2-58408)

Discover related pathways, diseases and genes to Cdc20 Antibody (NBP2-58408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc20 Antibody (NBP2-58408)

Discover more about diseases related to Cdc20 Antibody (NBP2-58408).
 

Pathways for Cdc20 Antibody (NBP2-58408)

View related products by pathway.

PTMs for Cdc20 Antibody (NBP2-58408)

Learn more about PTMs related to Cdc20 Antibody (NBP2-58408).
 

Research Areas for Cdc20 Antibody (NBP2-58408)

Find related products by research area.

Blogs on Cdc20

There are no specific blogs for Cdc20, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdc20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC20