Cdc14B Recombinant Protein Antigen

Images

 
There are currently no images for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cdc14B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cdc14B.

Source: E.coli

Amino Acid Sequence: RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC14B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68821. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Cdc14B Recombinant Protein Antigen

  • CDC14 cell division cycle 14 homolog B (S. cerevisiae)
  • CDC14 cell division cycle 14 homolog B
  • S. cerevisiae) homolog B

Background

Cdc14B is encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-1923
Species: Ce
Applications: IHC, IHC-P, IP, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00000995-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, S-ELISA, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-49142
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-68821PEP
Species: Hu
Applications: AC

Publications for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP) (0)

There are no publications for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP) (0)

There are no reviews for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdc14B Products

Bioinformatics Tool for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)

Discover related pathways, diseases and genes to Cdc14B Recombinant Protein Antigen (NBP2-68821PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)

Discover more about diseases related to Cdc14B Recombinant Protein Antigen (NBP2-68821PEP).
 

Pathways for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)

View related products by pathway.

PTMs for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)

Learn more about PTMs related to Cdc14B Recombinant Protein Antigen (NBP2-68821PEP).
 

Research Areas for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)

Find related products by research area.

Blogs on Cdc14B

There are no specific blogs for Cdc14B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cdc14B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC14B