Cdc14B Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cdc14B. Source: E.coli
Amino Acid Sequence: RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
CDC14B |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This peptide is useful as a blocking peptide for NBP2-68821. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here. |
Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for Cdc14B Recombinant Protein Antigen
Background
Cdc14B is encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Ce
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: AC
Publications for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP) (0)
There are no publications for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP) (0)
There are no reviews for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP) (0)
Additional Cdc14B Products
Bioinformatics Tool for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)
Discover related pathways, diseases and genes to Cdc14B Recombinant Protein Antigen (NBP2-68821PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)
Discover more about diseases related to Cdc14B Recombinant Protein Antigen (NBP2-68821PEP).
| | Pathways for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)
View related products by pathway.
|
PTMs for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)
Learn more about PTMs related to Cdc14B Recombinant Protein Antigen (NBP2-68821PEP).
| | Research Areas for Cdc14B Recombinant Protein Antigen (NBP2-68821PEP)
Find related products by research area.
|
Blogs on Cdc14B