Cdc14A Recombinant Protein Antigen

Images

 
There are currently no images for Cdc14A Protein (NBP1-84573PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cdc14A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC14A.

Source: E. coli

Amino Acid Sequence: QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC14A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84573.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cdc14A Recombinant Protein Antigen

  • CDC10 (cell division cycle 10, S. cerevisiae, homolog)
  • CDC14 cell division cycle 14 homolog A (S. cerevisiae)
  • CDC14 cell division cycle 14 homolog A
  • cdc14
  • Cdc14A1
  • Cdc14A2
  • dual specificity protein phosphatase CDC14A
  • EC 3.1.3.16
  • EC 3.1.3.48
  • hCDC14

Background

Overproduction of hCdc14A leads to progressive cell death, accompanied by accumulation of pre-G1 DNA fragments and gradual elimination of cells at the G2/M transition. In 50% of the mitotic cells, multipolar mitotic spindles and misaggregated chromosomes are found. hCdc14A localizes to the centrosomes at the cell-cycle interphase stage. When the cell enters mitosis, this localization disappears suggesting that hCdc14A dissociates from the centrosomes at the G2/M transition. hCdc14A localizes to interphase centrosomes, but not to mitotic centrosomes, while hCdc14B localizes to the interphase nucleolus. Thus each isoform regulates separate cell cycle events. Cdc14A may affect cell cycle progression by its ability to dephosphorylate p53 at Ser315. This phosphatase activity is mediated by the interaction between the N-terminus of hCdc14A and the C-terminus of p53.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84572
Species: Hu, Pm
Applications: IHC,  IHC-P
NBP2-58701
Species: Hu
Applications: ICC/IF
NBP2-82991
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-33867
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-86653
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP1-85720
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF4885
Species: Mu
Applications: IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-77310
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB4459
Species: Hu, Mu, Rt
Applications: WB

Publications for Cdc14A Protein (NBP1-84573PEP) (0)

There are no publications for Cdc14A Protein (NBP1-84573PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc14A Protein (NBP1-84573PEP) (0)

There are no reviews for Cdc14A Protein (NBP1-84573PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cdc14A Protein (NBP1-84573PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdc14A Products

Array NBP1-84573PEP

Research Areas for Cdc14A Protein (NBP1-84573PEP)

Find related products by research area.

Blogs on Cdc14A

There are no specific blogs for Cdc14A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cdc14A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC14A