Recombinant Human Cdc14A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cdc14A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 431-530 of Human CDC14A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDC14A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cdc14A Protein

  • CDC10 (cell division cycle 10, S. cerevisiae, homolog)
  • CDC14 cell division cycle 14 homolog A (S. cerevisiae)
  • CDC14 cell division cycle 14 homolog A
  • cdc14
  • Cdc14A1
  • Cdc14A2
  • dual specificity protein phosphatase CDC14A
  • EC 3.1.3.16
  • EC 3.1.3.48
  • hCDC14

Background

CDC14A - CDC14 cell division cycle 14 homolog A (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008555-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-58701
Species: Hu
Applications: ICC/IF
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77310
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008556-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cdc14A Partial Recombinant Protein (H00008556-Q01) (0)

There are no publications for Cdc14A Partial Recombinant Protein (H00008556-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc14A Partial Recombinant Protein (H00008556-Q01) (0)

There are no reviews for Cdc14A Partial Recombinant Protein (H00008556-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdc14A Partial Recombinant Protein (H00008556-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdc14A Products

Bioinformatics Tool for Cdc14A Partial Recombinant Protein (H00008556-Q01)

Discover related pathways, diseases and genes to Cdc14A Partial Recombinant Protein (H00008556-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc14A Partial Recombinant Protein (H00008556-Q01)

Discover more about diseases related to Cdc14A Partial Recombinant Protein (H00008556-Q01).
 

Pathways for Cdc14A Partial Recombinant Protein (H00008556-Q01)

View related products by pathway.

PTMs for Cdc14A Partial Recombinant Protein (H00008556-Q01)

Learn more about PTMs related to Cdc14A Partial Recombinant Protein (H00008556-Q01).
 

Research Areas for Cdc14A Partial Recombinant Protein (H00008556-Q01)

Find related products by research area.

Blogs on Cdc14A

There are no specific blogs for Cdc14A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Cdc14A Antibody
NBP1-84573

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cdc14A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC14A