| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IP |
| Clone | 7A10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse CDAN1 Antibody (7A10) - Azide and BSA Free (H00146059-M01-100ug) is a monoclonal antibody validated for use in WB, ELISA and IP. Anti-CDAN1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | CDAN1 (NP_612486.2, 1130 a.a. ~ 1227 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CDAN1 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
| Publication using H00146059-M01-100ug | Applications | Species |
|---|---|---|
| Shroff M, Knebel A, Toth R et al. A complex comprising C15ORF41 and Codanin-1- the products of two genes mutated in congenital dyserythropoietic anemia type I (CDA-I). Biochem J. 2020-04-02 [PMID: 32239177] |
Secondary Antibodies |
Isotype Controls |
Research Areas for CDAN1 Antibody (H00146059-M01-100ug)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDAN1 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|