CD99 Antibody


Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650] - Staining of human pancreas shows membranous positivity in islets of Langerhans.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CD99 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL
Specificity of human CD99 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD99 Protein (NBP1-82650PEP)
Read Publication using NBP1-82650.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22392539)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD99 Antibody

  • 12E7
  • antigen identified by monoclonal antibodies 12E7, F21 and O13
  • CD99 antigenY homolog
  • CD99 molecule
  • CD99
  • E2 antigen
  • HBA71
  • MIC2 (monoclonal 12E7)
  • MIC2
  • MIC2Y
  • MSK5X
  • pilr-1
  • PILR-L
  • Protein MIC2
  • surface antigen MIC2
  • T-cell surface glycoprotein E2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD99 Antibody (NBP1-82650)(1)

Reviews for CD99 Antibody (NBP1-82650) (0)

There are no reviews for CD99 Antibody (NBP1-82650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD99 Antibody (NBP1-82650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD99 Products

Bioinformatics Tool for CD99 Antibody (NBP1-82650)

Discover related pathways, diseases and genes to CD99 Antibody (NBP1-82650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD99 Antibody (NBP1-82650)

Discover more about diseases related to CD99 Antibody (NBP1-82650).

Pathways for CD99 Antibody (NBP1-82650)

View related products by pathway.

PTMs for CD99 Antibody (NBP1-82650)

Learn more about PTMs related to CD99 Antibody (NBP1-82650).

Research Areas for CD99 Antibody (NBP1-82650)

Find related products by research area.

Blogs on CD99

There are no specific blogs for CD99, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD99 Antibody and receive a gift card or discount.


Gene Symbol CD99