CD96 Antibody

Images

 
Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining in human lymph node and skeletal muscle tissues. Corresponding CD96 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CD96 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT
Specificity
Specificity of human CD96 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD96
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD96 Recombinant Protein Antigen (NBP2-49491PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD96 Antibody

  • CD96 antigenMGC22596
  • CD96 molecule
  • CD96
  • DKFZp667E2122
  • T cell-activated increased late expression protein
  • TACTILE
  • TACTILEincreased late expression
  • T-cell surface protein tactile

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF666
Species: Hu
Applications: WB, Neut
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2229
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
DDX0300P-100
Species: Hu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NBP2-13843
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC

Publications for CD96 Antibody (NBP2-49491) (0)

There are no publications for CD96 Antibody (NBP2-49491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD96 Antibody (NBP2-49491) (0)

There are no reviews for CD96 Antibody (NBP2-49491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD96 Antibody (NBP2-49491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CD96 Antibody (NBP2-49491)

Discover related pathways, diseases and genes to CD96 Antibody (NBP2-49491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD96 Antibody (NBP2-49491)

Discover more about diseases related to CD96 Antibody (NBP2-49491).
 

Pathways for CD96 Antibody (NBP2-49491)

View related products by pathway.

Blogs on CD96

There are no specific blogs for CD96, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD96 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD96