CD96 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining in human lymph node and skeletal muscle tissues . Corresponding CD96 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD96 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD96 Antibody - BSA Free (NBP2-49491) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD96
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD96 Recombinant Protein Antigen (NBP2-49491PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD96 Antibody - BSA Free

• CD96 antigenMGC22596
• CD96 molecule
• CD96
• DKFZp667E2122
• T cell-activated increased late expression protein
• TACTILE
• TACTILEincreased late expression
• T-cell surface protein tactile

Background

CD96 is encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also function in antigen presentation. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD96