ARHGEF1 Antibody

Images

 
Western Blot: ARHGEF1 Antibody [NBP1-82843] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ARHGEF1 Antibody [NBP1-82843] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: ARHGEF1 Antibody [NBP1-82843] - Staining of human lymph node shows strong cytoplasmic positivity.
Western Blot: ARHGEF1 Antibody [NBP1-82843] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500-1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGEF1 Protein (NBP1-82843PEP)
Publications
Read Publication using NBP1-82843.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF1 Antibody

  • 115 kDa guanine nucleotide exchange factor
  • 115-kD protein
  • GEF1
  • LBCL2LSC
  • Lsc homolog
  • p115RhoGEF
  • P115-RHOGEF
  • Rho guanine nucleotide exchange factor (GEF) 1
  • rho guanine nucleotide exchange factor 1
  • SUB1.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4737
Species: Hu
Applications: WB
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF6260
Species: Hu
Applications: WB
NBP2-24517
Species: Hu, Rt, Bv, Pm
Applications: WB, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARHGEF1 Antibody (NBP1-82843)(1)

Reviews for ARHGEF1 Antibody (NBP1-82843) (0)

There are no reviews for ARHGEF1 Antibody (NBP1-82843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGEF1 Antibody (NBP1-82843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF1 Products

Bioinformatics Tool for ARHGEF1 Antibody (NBP1-82843)

Discover related pathways, diseases and genes to ARHGEF1 Antibody (NBP1-82843). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF1 Antibody (NBP1-82843)

Discover more about diseases related to ARHGEF1 Antibody (NBP1-82843).
 

Pathways for ARHGEF1 Antibody (NBP1-82843)

View related products by pathway.

PTMs for ARHGEF1 Antibody (NBP1-82843)

Learn more about PTMs related to ARHGEF1 Antibody (NBP1-82843).
 

Research Areas for ARHGEF1 Antibody (NBP1-82843)

Find related products by research area.

Blogs on ARHGEF1

There are no specific blogs for ARHGEF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF1
Entrez
Uniprot