CD77 Synthase Antibody


Immunocytochemistry/ Immunofluorescence: CD77 Synthase Antibody [NBP2-57614] - Staining of human cell line U-2 OS shows localization to nuclear bodies & mitochondria.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

CD77 Synthase Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD',)
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD77 Synthase Recombinant Protein Antigen (NBP2-57614PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CD77 Synthase Antibody

  • A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group)
  • A4GALT1
  • alpha 1,4-galactosyltransferase
  • Alpha-1,4-galactosyltransferase
  • alpha-1,4-N-acetylglucosaminyltransferase
  • alpha4Gal-T1
  • CD77 synthase
  • EC
  • Gb3 synthase
  • Gb3S
  • Globotriaosylceramide synthase
  • lactosylceramide 4-alpha-galactosyltransferase
  • P blood group (P one antigen)
  • P(k) antigen synthase
  • P(k)
  • P1
  • P1/Pk synthase
  • PK
  • UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for CD77 Synthase Antibody (NBP2-57614) (0)

There are no publications for CD77 Synthase Antibody (NBP2-57614).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD77 Synthase Antibody (NBP2-57614) (0)

There are no reviews for CD77 Synthase Antibody (NBP2-57614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CD77 Synthase Antibody (NBP2-57614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD77 Synthase Products

Bioinformatics Tool for CD77 Synthase Antibody (NBP2-57614)

Discover related pathways, diseases and genes to CD77 Synthase Antibody (NBP2-57614). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD77 Synthase Antibody (NBP2-57614)

Discover more about diseases related to CD77 Synthase Antibody (NBP2-57614).

Blogs on CD77 Synthase

There are no specific blogs for CD77 Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD77 Synthase Antibody and receive a gift card or discount.


Gene Symbol A4GALT