CD77 Synthase Antibody


Western Blot: CD77 Synthase Antibody [NBP1-69594] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: HT1080 cell lysate

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CD77 Synthase Antibody Summary

Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT. Peptide sequence VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFK
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against A4GALT and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CD77 Synthase Antibody

  • A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group)
  • A4GALT1
  • alpha 1,4-galactosyltransferase
  • Alpha-1,4-galactosyltransferase
  • alpha-1,4-N-acetylglucosaminyltransferase
  • alpha4Gal-T1
  • CD77 synthase
  • EC
  • Gb3 synthase
  • Gb3S
  • Globotriaosylceramide synthase
  • lactosylceramide 4-alpha-galactosyltransferase
  • P blood group (P one antigen)
  • P(k) antigen synthase
  • P(k)
  • P1
  • P1/Pk synthase
  • PK
  • UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase


The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein fou


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB

Publications for CD77 Synthase Antibody (NBP1-69594) (0)

There are no publications for CD77 Synthase Antibody (NBP1-69594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD77 Synthase Antibody (NBP1-69594) (0)

There are no reviews for CD77 Synthase Antibody (NBP1-69594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD77 Synthase Antibody (NBP1-69594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD77 Synthase Products

Bioinformatics Tool for CD77 Synthase Antibody (NBP1-69594)

Discover related pathways, diseases and genes to CD77 Synthase Antibody (NBP1-69594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD77 Synthase Antibody (NBP1-69594)

Discover more about diseases related to CD77 Synthase Antibody (NBP1-69594).

Blogs on CD77 Synthase

There are no specific blogs for CD77 Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD77 Synthase Antibody and receive a gift card or discount.


Gene Symbol A4GALT