CD74 Antibody

Images

 
Western Blot: CD74 Antibody [NBP1-85225] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: CD74 Antibody [NBP1-85225] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: CD74 Antibody [NBP1-85225] - Staining of human tonsil shows strong membranous and cytoplasmic positivity in germinal center cells and in non-germinal center cells.
Immunohistochemistry-Paraffin: CD74 Antibody [NBP1-85225] - Staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: CD74 Antibody [NBP1-85225] - Staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD74 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD74
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD74 Protein (NBP1-85225PEP)
Publications
Read Publications using
NBP1-85225 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24594996).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD74 Antibody

  • CD74 antigen (invariant polypeptide of major histocompatibility complex, classII antigen-associated)
  • CD74 antigen
  • CD74 molecule, major histocompatibility complex, class II invariant chain
  • CD74
  • CLIP
  • DHLAG
  • DHLAGgamma chain of class II antigens
  • HLA class II histocompatibility antigen gamma chain
  • HLADG
  • HLA-DR antigens-associated invariant chain
  • HLA-DR-gamma
  • Ia antigen-associated invariant chain
  • Ia-associated invariant chain
  • Ia-gamma
  • Ii
  • INVG34
  • MHC HLA-DR gamma chain
  • p33

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF7250
Species: Hu
Applications: IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34118
Species: Hu
Applications: IHC, IHC-P

Publications for CD74 Antibody (NBP1-85225)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CD74 Antibody (NBP1-85225) (0)

There are no reviews for CD74 Antibody (NBP1-85225). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD74 Antibody (NBP1-85225) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD74 Products

Bioinformatics Tool for CD74 Antibody (NBP1-85225)

Discover related pathways, diseases and genes to CD74 Antibody (NBP1-85225). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD74 Antibody (NBP1-85225)

Discover more about diseases related to CD74 Antibody (NBP1-85225).
 

Pathways for CD74 Antibody (NBP1-85225)

View related products by pathway.

PTMs for CD74 Antibody (NBP1-85225)

Learn more about PTMs related to CD74 Antibody (NBP1-85225).
 

Research Areas for CD74 Antibody (NBP1-85225)

Find related products by research area.

Blogs on CD74.

CD74 - a central player in antigen presentation by MHC class II
Cluster of differentiation 74 (CD74) is an important integral membrane protein that serves as a chaperone for MHC class II molecules. CD74, also known as the invariant chain or Ii, is needed for the proper folding and trafficking of MHC class II in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD74 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD74
Entrez