Immunohistochemistry: Advillin Antibody [NBP2-34118] - Immunohistochemistry of paraffin embedded tissue from distal ileum of C57BL/6 J mice using N-villin (red) and advillin (green) antibodies. Nuclei are counter ...read more
Western Blot: Advillin Antibody [NBP2-34118] - Specificity of villin and advillin antibodies was confirmed by Western analysis using recombinant full-length human villin and human advillin proteins. Two antibodies ...read more
Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human lymphoid tissues shows no positivity as expected.
Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human stomach shows strong cytoplasmic positivity in neuroendocrine cells.
Immunohistochemistry-Paraffin: Advillin Antibody [NBP2-34118] - Staining of human duodenum shows strong cytoplasmic positivity in neuroendocrine cells.
This antibody was developed against a recombinant protein corresponding to amino acids: HASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPA
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AVIL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Advillin Antibody
ADVIL
advillin
DOC6
FLJ12386
MGC133244
p92DKFZp779O1812
Background
Advillin, also known as AVIL, contains two isoforms that are 92 kDa and 91 kDa, and is involved in the development of ganglia and the regeneration and remodeling of axons after a peripheral injury occurs. Current research is being conducted on this calcium regulated actin-binding protein to determine its relation with a variety of diseases and disorders, including petit mal status, prostatitis, inflammatory bowel disease, neuronitis, dengue hemorrhagic fever, dacryoadenitis, and dengue shock syndrome. Advillin has been linked to stress response, cytoskeleton organization, and nervous system development, through which it interacts with proteins CRK and HDAC8.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for Advillin Antibody (NBP2-34118)
Discover related pathways, diseases and genes to Advillin Antibody (NBP2-34118). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Advillin Antibody (NBP2-34118)
Discover more about diseases related to Advillin Antibody (NBP2-34118).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Advillin Antibody and receive a gift card or discount.