CD69 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CD69 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD69.
  
  

  Source: E. coli

  Amino Acid Sequence: VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CD69
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37926.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD69 Recombinant Protein Antigen

• activation inducer molecule (AIM/CD69)
• Activation inducer molecule
• AIM
• BL-AC/P26
• CD69 antigen (p60, early T-cell activation antigen)
• CD69 antigen
• CD69 molecule
• CD69
• CLEC2CC-type lectin domain family 2 member C
• C-type lectin domain family 2, member C
• EA1
• EA-1
• early activation antigen CD69
• early lymphocyte activation antigen
• Early T-cell activation antigen p60
• GP32/28
• Leu23
• Leukocyte surface antigen Leu-23
• MLR-3
• p60

Background

CD69, also known as very early activation (VEA) antigen, is a disulfide-linked transmembrane homodimer whose differentially glycosylated subunits range from 35-39 kDa. (1,2) It is a C-type lectin, most closely related to the NKR-P1 and Ly-49 NK cell-activation molecules. (3) CD69 is widely expressed on hematopoietic cells, including lymphocytes, neutrophils and eosinophils. (1-4) Although not detectable on resting lymphocytes, its expression is rapidly (within 2 hours) upregulated upon activation of T, B and NK cells, and neutrophils. (4) Constitutive expression of CD69 on subsets of thymocytes suggests that it may be involved in regulation of developmental events in addition to its role in activation of a variety of hematopoietic cells. (4,5) MAb H1.2F3 augments PMA-induced T-cell proliferation,1,6 and induces redirected lysis of Fc receptor-bearing target cells by NK cells. (7)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CD69