CD68/SR-D1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD68/SR-D1. Source: E. coli
Amino Acid Sequence: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CD68 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48923. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CD68/SR-D1 Recombinant Protein Antigen
Background
Human CD68, also known as GP110, LAMP4, Scavenger Receptor D1 (SR-D1) or macrosialin in mouse, encodes a 110-kD transmembrane glycoprotein that belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. Members of the LAMP family include LAMP-1, LAMP-2, dendritic cell (DC)-LAMP (aka CD208), and brain and dendritic cell-associated (BAD)-LAMP (aka LAMP-5). Unlike the two LAMP domains facing the lysosomal lumen in LAMP-1 and LAMP-2, CD68 has a single LAMP domain containing four cystines spaced 36-37 residues apart along with an N-terminal Mucin-like domain. The 354 amino acid (a.a.) human CD68 and 326 a.a. murine ortholog share 80.6% a.a. sequence identity (1).
CD68 is highly expressed in cells of the mononuclear phagocyte system such as macrophages, microglia, osteoclasts, and myeloid dendritic cells (DCs); and is expressed to a lesser extent in lymphoid cells (CD19+ B lymphocytes and CD4+ T lymphocytes), human umbilical cord mesenchymal stem cells (MSCs), fibroblasts, endothelial cells, multiple non-hematopoietic cancer cell lines, and human arterial intimal smooth muscle cells (SMCs). Expression has been also observed in diseased states for granulocytes and neutrophils, in particular basophils from myeloproliferative disorders and intestinal neutrophils from inflammatory bowel disease (IBD), respectively (1).
Although the function of CD68 has yet to be established, it has often been used as an immunohistochemistry (IHC) marker of inflammation and for granular cell tumors (GCTs). CD68+ tumor associated macrophages (TAMs) has been suggested to be a predictive marker for poor cancer prognosis, but a meta-analysis showed the presence of CD68 is not correlated with survival (2). In addition, a role in hepatic malaria infection has been reported based on the finding that peptide P39 binds CD68, considered a receptor for malaria sporozoite, and inhibits parasite entry into Kupffer cells. CD68 was deemed a member of the Scavenger receptor family due to its upregulation in macrophages following inflammatory stimuli, ability to bind modified LDL, phosphatidylserine, and apoptotic cells, as well as shuttling between the plasma membrane and endosomes. CD68 has been linked to atherogenesis based on binding and internalization of its ligand, oxLDL (1).
References
1. Chistiakov, DA, Killingsworth, MC, Myasoedova, VA. Orekhov AN, Bobryshev YV. (2017) CD68/macrosialin: not just a histochemical marker. Lab Invest. 97:4-13. PMID: 27869795
2. Troiano G, Caponio VCA, Adipietro I, Tepedino M, Santoro R, Laino L, Lo Russo L, Cirillo N, Lo Muzio L. (2019) Prognostic significance of CD68+ and CD163+ tumor associated macrophages in head and neck squamous cell carcinoma: A systematic review and meta-analysis. Oral Oncol. 93:66-75. PMID: 31109698.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Rt
Applications: IHC, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Publications for CD68/SR-D1 Recombinant Protein Antigen (NBP2-48923PEP) (0)
There are no publications for CD68/SR-D1 Recombinant Protein Antigen (NBP2-48923PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD68/SR-D1 Recombinant Protein Antigen (NBP2-48923PEP) (0)
There are no reviews for CD68/SR-D1 Recombinant Protein Antigen (NBP2-48923PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CD68/SR-D1 Recombinant Protein Antigen (NBP2-48923PEP) (0)