CD37 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human tonsil shows strong membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human tonsil shows high expression.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining in human tonsil and cerebral cortex tissues using anti-CD37 antibody. Corresponding CD37 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human lymph node.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human testis.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human spleen.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Analysis in human tonsil and skeletal muscle tissues. Corresponding CD37 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human cerebral cortex, lymph node, skeletal muscle and tonsil using Anti-CD37 antibody NBP2-33970 (A) shows similar protein distribution across tissues to independent antibody NBP2-33969 (B).

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: CD37 Antibody [NBP2-33970] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD37 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD37
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD37 Protein (NBP2-33970PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD37 Antibody - BSA Free

• CD37 antigentetraspanin-26
• CD37 molecule
• CD37
• cell differentiation antigen 37
• GP52-40
• leukocyte antigen CD37
• MGC120234
• Tetraspanin-26
• TSPAN26
• tspan-26
• TSPAN26leukocyte surface antigen CD37

Background

CD37, also known as GP52-40, TSPAN26, MGC120234. Enterz Protein NP_001035120. It is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD37
• Uniprot:
  • P11049()