CD300f/LMIR3/CD300LF Antibody

Images

 
Immunohistochemistry: CD300f/LMIR3/CD300LF Antibody [NBP2-14463] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD300f/LMIR3/CD300LF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SIVTQITGPTTVNGLERGSLTVQCVYRSGWEAYLKWWCRGAIWRDCKILV KTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGND LGVTVQVTIDPASTTASTPAPTTPTSTTFTAPITQEETSSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD300LF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD300f/LMIR3/CD300LF Protein (NBP2-14463PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD300f/LMIR3/CD300LF Antibody

  • CMRF35-like molecule 1
  • CD300 molecule-like family member f
  • CD300f
  • CD300LF
  • CLIM1
  • CLM1
  • CLM-1
  • DIgR2
  • IGSF13
  • IREM1
  • IREM-1
  • LMIR3
  • NKIR
  • Pigr3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP1-84432
Species: Hu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for CD300f/LMIR3/CD300LF Antibody (NBP2-14463) (0)

There are no publications for CD300f/LMIR3/CD300LF Antibody (NBP2-14463).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD300f/LMIR3/CD300LF Antibody (NBP2-14463) (0)

There are no reviews for CD300f/LMIR3/CD300LF Antibody (NBP2-14463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD300f/LMIR3/CD300LF Antibody (NBP2-14463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD300f/LMIR3/CD300LF Products

Bioinformatics Tool for CD300f/LMIR3/CD300LF Antibody (NBP2-14463)

Discover related pathways, diseases and genes to CD300f/LMIR3/CD300LF Antibody (NBP2-14463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD300f/LMIR3/CD300LF Antibody (NBP2-14463)

Discover more about diseases related to CD300f/LMIR3/CD300LF Antibody (NBP2-14463).
 

Pathways for CD300f/LMIR3/CD300LF Antibody (NBP2-14463)

View related products by pathway.

Blogs on CD300f/LMIR3/CD300LF

There are no specific blogs for CD300f/LMIR3/CD300LF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD300f/LMIR3/CD300LF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD300LF
Entrez