CD229/SLAMF3/Lymphocyte Antigen 9 Antibody - BSA Free

Western Blot: CD229/SLAMF3/Lymphocyte Antigen 9 Antibody [NBP2-30776] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: CD229/SLAMF3/Lymphocyte Antigen 9 Antibody [NBP2-30776] - Staining of human kidney showing strong membranous positivity in cells of various tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD229/SLAMF3/Lymphocyte Antigen 9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LY9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody - BSA Free

• CD229 antigen
• CD229
• cell-surface molecule Ly-9
• hly9
• Ly9
• lymphocyte antigen 9Cell surface molecule Ly-9
• mLY9
• SLAMF3
• T-lymphocyte surface antigen Ly-9

Background

LY9, also known as T-lymphocyte surface Antigen Ly-9, consists of four isoforms of sizes 72.1 kDa, 70.7 kDa, 57.3 kDa, and 72 kDa and interacts with adaptor molecules as an immunomodulatory receptor and member of the SLAM family. Current research is being conducted to identify the effect of the protein on diseases and disorders such as myeloma, hepatitis, lymphoproliferative syndrome, and dysgammaglobulinemia. The protein is involved in cell adhesion pathways with SH2D1A, AP2M1, PTPN11, GRB2, and SH2D1B proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LY9
• Uniprot:
  • Q9HBG7()