CD229/SLAMF3/Lymphocyte Antigen 9 Antibody


Western Blot: CD229/SLAMF3/Lymphocyte Antigen 9 Antibody [NBP2-30776] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CD229/SLAMF3/Lymphocyte Antigen 9 Antibody [NBP2-30776] - Staining of human kidney showing strong membranous positivity in cells of various tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CD229/SLAMF3/Lymphocyte Antigen 9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE
Specificity of human CD229/SLAMF3/Lymphocyte Antigen 9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody

  • CD229 antigen
  • CD229
  • cell-surface molecule Ly-9
  • hly9
  • Ly9
  • lymphocyte antigen 9Cell surface molecule Ly-9
  • mLY9
  • SLAMF3
  • T-lymphocyte surface antigen Ly-9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, B/N
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC

Publications for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)

There are no publications for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)

There are no reviews for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)

Discover related pathways, diseases and genes to CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)

Discover more about diseases related to CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776).

Pathways for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)

View related products by pathway.

PTMs for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)

Learn more about PTMs related to CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776).

Blogs on CD229/SLAMF3/Lymphocyte Antigen 9

There are no specific blogs for CD229/SLAMF3/Lymphocyte Antigen 9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD229/SLAMF3/Lymphocyte Antigen 9 Antibody and receive a gift card or discount.


Gene Symbol LY9