CD229/SLAMF3/Lymphocyte Antigen 9 Antibody

Images

 
Western Blot: CD229/SLAMF3/Lymphocyte Antigen 9 Antibody [NBP2-30776] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CD229/SLAMF3/Lymphocyte Antigen 9 Antibody [NBP2-30776] - Staining of human kidney showing strong membranous positivity in cells of various tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD229/SLAMF3/Lymphocyte Antigen 9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LY9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD229/SLAMF3/Lymphocyte Antigen 9 Protein (NBP2-30776PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody

  • CD229 antigen
  • CD229
  • cell-surface molecule Ly-9
  • hly9
  • Ly9
  • lymphocyte antigen 9Cell surface molecule Ly-9
  • mLY9
  • SLAMF3
  • T-lymphocyte surface antigen Ly-9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004068-M01
Species: Hu
Applications: WB, ELISA
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1855
Species: Hu
Applications: WB
MAB19081
Species: Hu
Applications: Flow, CyTOF-ready
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
AF3327
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1039
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP2-33733
Species: Hu
Applications: IHC, IHC-P
NBP1-84590
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45549
Species: Hu
Applications: WB, Flow, IHC

Publications for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)

There are no publications for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)

There are no reviews for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD229/SLAMF3/Lymphocyte Antigen 9 Products

Bioinformatics Tool for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)

Discover related pathways, diseases and genes to CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)

Discover more about diseases related to CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776).
 

Pathways for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)

View related products by pathway.

PTMs for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)

Learn more about PTMs related to CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776).

Blogs on CD229/SLAMF3/Lymphocyte Antigen 9

There are no specific blogs for CD229/SLAMF3/Lymphocyte Antigen 9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD229/SLAMF3/Lymphocyte Antigen 9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LY9
Entrez
Uniprot