CD229/SLAMF3/Lymphocyte Antigen 9 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CD229/SLAMF3/Lymphocyte Antigen 9 Antibody - BSA Free (NBP2-30776) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LY9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody - BSA Free
Background
LY9, also known as T-lymphocyte surface Antigen Ly-9, consists of four isoforms of sizes 72.1 kDa, 70.7 kDa, 57.3 kDa, and 72 kDa and interacts with adaptor molecules as an immunomodulatory receptor and member of the SLAM family. Current research is being conducted to identify the effect of the protein on diseases and disorders such as myeloma, hepatitis, lymphoproliferative syndrome, and dysgammaglobulinemia. The protein is involved in cell adhesion pathways with SH2D1A, AP2M1, PTPN11, GRB2, and SH2D1B proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Publications for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)
There are no publications for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)
There are no reviews for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD229/SLAMF3/Lymphocyte Antigen 9 Products
Research Areas for CD229/SLAMF3/Lymphocyte Antigen 9 Antibody (NBP2-30776)
Find related products by research area.
|
Blogs on CD229/SLAMF3/Lymphocyte Antigen 9