CD200/OX2 Antibody

Images

 
Immunohistochemistry-Paraffin: CD200/OX2 Antibody [NBP1-87738] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, PmSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD200/OX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD200
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD200/OX2 Protein (NBP1-87738PEP)
Publications
Read Publication using
NBP1-87738 in the following applications:

Reactivity Notes

Primate reactivity reported in scientific literature (PMID: 25599132).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD200/OX2 Antibody

  • antigen identified by monoclonal MRC OX-2
  • CD200 antigenMOX1
  • CD200 molecule
  • CD200
  • MOX1
  • MOX2
  • MOX2MRC
  • MRC OX-2 antigen
  • MRC
  • OX-2 membrane glycoprotein
  • OX-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF2554
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-53308
Species: Hu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP1-87738
Species: Hu, Pm
Applications: IHC, IHC-P

Publications for CD200/OX2 Antibody (NBP1-87738)(1)

We have publications tested in 1 confirmed species: Primate.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Primate
(1)
All Species

Reviews for CD200/OX2 Antibody (NBP1-87738) (0)

There are no reviews for CD200/OX2 Antibody (NBP1-87738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD200/OX2 Antibody (NBP1-87738). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in using your CD200 antibody on canine skin sections (paraffin fixed) for IHC. When comparing the human epitope with the dog's protein, there is 76% ident. Do you as an antibody manufacturer have any experience if this percentage is enough for an antibody to recognize a protein?
    • Generally we recommend that an immunogen share over 80-85% similarity but having taken a look at the immunogen aligned with the dog sequence, there are several stretches of high similarity. As NBP1-87738 is a polyclonal, there will almost certainly be antibodies in the vial that will cross-react with dog. You may need to use this antibody at a higher concentration than is recommended, but there is a high chance that this antibody will cross-react.

Secondary Antibodies

 

Isotype Controls

Additional CD200/OX2 Products

Bioinformatics Tool for CD200/OX2 Antibody (NBP1-87738)

Discover related pathways, diseases and genes to CD200/OX2 Antibody (NBP1-87738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD200/OX2 Antibody (NBP1-87738)

Discover more about diseases related to CD200/OX2 Antibody (NBP1-87738).
 

Pathways for CD200/OX2 Antibody (NBP1-87738)

View related products by pathway.

PTMs for CD200/OX2 Antibody (NBP1-87738)

Learn more about PTMs related to CD200/OX2 Antibody (NBP1-87738).

Blogs on CD200/OX2

There are no specific blogs for CD200/OX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD200/OX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD200
Entrez