CD200/OX2 Antibody

Immunohistochemistry-Paraffin: CD200/OX2 Antibody [NBP1-87738] - Analysis in human cerebral cortex and liver tissues. Corresponding CD200 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD200/OX2 Antibody [NBP1-87738] - Staining of human cerebral cortex shows strong positivity in neurons.

Immunohistochemistry-Paraffin: CD200/OX2 Antibody [NBP1-87738] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: CD200/OX2 Antibody [NBP1-87738] - Staining of human tonsil shows moderate to strong membranous positivity in lymphoid cells.

Immunohistochemistry-Paraffin: CD200/OX2 Antibody [NBP1-87738] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

CD200/OX2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD200
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: ICC/IF reported in scientific literature (PMID: 25599132). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Primate reactivity reported in scientific literature (PMID: 25599132).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD200/OX2 Antibody

• antigen identified by monoclonal MRC OX-2
• CD200 antigenMOX1
• CD200 molecule
• CD200
• MOX1
• MOX2
• MOX2MRC
• MRC OX-2 antigen
• MRC
• OX-2 membrane glycoprotein
• OX-2

Background

CD200 costimulates T cell proliferation. It may regulate myeloid cell activity in a variety of tissues. It is a monomorphic determinant expressed on thymocytes, brain, follicular dendritic cells in all lymphoid organs, endothelium and at low levels on some smooth muscle and B lymphocytes. Recent studies have suggested that the CD200 - CD200 ligand system is of importance in the control of macrophage and granulocyte activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CD200/OX2 Antibody (NBP1-87738)(1)

Publication using NBP1-87738

• Fukazawa Y, Lum R, Okoye AA et al. A B cell follicle sanctuary permits persistent productive SIV infection in elite controllers. Nat Med 2015-02-01 [PMID: 25599132] (ICC/IF, Primate)

FAQs for CD200/OX2 Antibody (NBP1-87738). (Showing 1 - 1 of 1 FAQ).

1. We are interested in using your CD200 antibody on canine skin sections (paraffin fixed) for IHC. When comparing the human epitope with the dog's protein, there is 76% ident. Do you as an antibody manufacturer have any experience if this percentage is enough for an antibody to recognize a protein?
   • Generally we recommend that an immunogen share over 80-85% similarity but having taken a look at the immunogen aligned with the dog sequence, there are several stretches of high similarity. As NBP1-87738 is a polyclonal, there will almost certainly be antibodies in the vial that will cross-react with dog. You may need to use this antibody at a higher concentration than is recommended, but there is a high chance that this antibody will cross-react.

Bioinformatics

• Gene Symbol: CD200