CD20 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MS4A1. Source: E. coli
Amino Acid Sequence: MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MS4A1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90052. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CD20 Recombinant Protein Antigen
Background
CD20 is a non-glycosylated phosphoprotein that is expressed on the surface of normal and malignant B cells and functions in mediating calcium transport and B cell differentiation (1,2). CD20 is encoded by the membrane-spanning 4-domain family A member 1 (MS4A1) gene and, in humans, is located on chromosome 11q12 (1). The CD20 protein is 297 amino acids (aa) in length with a theoretical molecular weight (MW) of 33 kDa (1,2). Structurally, the CD20 protein has four membrane-spanning domains, two extracellular loop domains, and intracellular N- and C-terminal domains (1,2). CD20 is expressed at specific stages of B cell maturation including pre-B cells, mature naive and activated B cells, and memory B cells, but is absent from plasmablasts and plasma cells (1,3,4). Expression of CD20 is often increased on malignant B cells associated with various B cell disorders such as chronic lymphocytic leukemia (CLL), multiple sclerosis (MS), and rheumatoid arthritis (2-4). Anti-CD20 monoclonal antibody (mAb)-based therapies have become an appealing target for treating these immune-related disorders and cancers (1-5). Rituximab, a chimeric mAb, was the first FDA approved CD20 monoclonal antibody for the treatment of non-Hodgkin's lymphoma that is now commonly used to treat MS (2,3). Since its initial approval in 1997, several other chimeric and humanized anti-CD20 mAbs have been developed including Ofatumumab, Ublituximab, and Obinutuzumab (1-5). B cell depletion via CD20 mAbs can occur under different mechanisms such as antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), complement-dependent cytotoxicity (CDC), and direct induction of apoptosis (1-4). Many ongoing studies are focused on combination therapies with CD20 mAbs as an addition to chemotherapy, B cell receptor (BCR) signaling inhibitors, or BH3 mimetics (1,2,4). Additionally, the effects of bispecific antibodies and CD20 chimeric antigen receptor (CAR) T cell therapies are under investigation for the treatment of B cell malignancies (4,5).
References
1. Pavlasova G, Mraz M. The regulation and function of CD20: an "enigma" of B-cell biology and targeted therapy. Haematologica. 2020; 105(6):1494-1506. https://doi.org/10.3324/haematol.2019.243543
2. Payandeh Z, Bahrami AA, Hoseinpoor R, et al. The applications of anti-CD20 antibodies to treat various B cells disorders. Biomed Pharmacother. 2019; 109:2415-2426. https://doi.org/10.1016/j.biopha.2018.11.121
3. Margoni M, Preziosa P, Filippi M, Rocca MA. Anti-CD20 therapies for multiple sclerosis: current status and future perspectives. J Neurol. 2022; 269(3):1316-1334. https://doi.org/10.1007/s00415-021-10744-x
4. Klein C, Jamois C, Nielsen T. Anti-CD20 treatment for B-cell malignancies: current status and future directions. Expert Opin Biol Ther. 2021; 21(2):161-181. https://doi.org/10.1080/14712598.2020.1822318
5. Sharman JP. Targeting CD20: teaching an old dog new tricks. Hematology Am Soc Hematol Educ Program. 2019; 2019(1):273-278. https://doi.org/10.1182/hematology.2019000031
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Publications for CD20 Recombinant Protein Antigen (NBP1-90052PEP) (0)
There are no publications for CD20 Recombinant Protein Antigen (NBP1-90052PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD20 Recombinant Protein Antigen (NBP1-90052PEP) (0)
There are no reviews for CD20 Recombinant Protein Antigen (NBP1-90052PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CD20 Recombinant Protein Antigen (NBP1-90052PEP) (0)