Recombinant Human CD20 Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 210-297 of Human CD20 Source: Wheat Germ Amino Acid Sequence: GIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
MS4A1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
35.42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human CD20 Protein
Background
CD20 is a non-glycosylated phosphoprotein that is expressed on the surface of normal and malignant B cells and functions in mediating calcium transport and B cell differentiation (1,2). CD20 is encoded by the membrane-spanning 4-domain family A member 1 (MS4A1) gene and, in humans, is located on chromosome 11q12 (1). The CD20 protein is 297 amino acids (aa) in length with a theoretical molecular weight (MW) of 33 kDa (1,2). Structurally, the CD20 protein has four membrane-spanning domains, two extracellular loop domains, and intracellular N- and C-terminal domains (1,2). CD20 is expressed at specific stages of B cell maturation including pre-B cells, mature naive and activated B cells, and memory B cells, but is absent from plasmablasts and plasma cells (1,3,4). Expression of CD20 is often increased on malignant B cells associated with various B cell disorders such as chronic lymphocytic leukemia (CLL), multiple sclerosis (MS), and rheumatoid arthritis (2-4). Anti-CD20 monoclonal antibody (mAb)-based therapies have become an appealing target for treating these immune-related disorders and cancers (1-5). Rituximab, a chimeric mAb, was the first FDA approved CD20 monoclonal antibody for the treatment of non-Hodgkin's lymphoma that is now commonly used to treat MS (2,3). Since its initial approval in 1997, several other chimeric and humanized anti-CD20 mAbs have been developed including Ofatumumab, Ublituximab, and Obinutuzumab (1-5). B cell depletion via CD20 mAbs can occur under different mechanisms such as antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), complement-dependent cytotoxicity (CDC), and direct induction of apoptosis (1-4). Many ongoing studies are focused on combination therapies with CD20 mAbs as an addition to chemotherapy, B cell receptor (BCR) signaling inhibitors, or BH3 mimetics (1,2,4). Additionally, the effects of bispecific antibodies and CD20 chimeric antigen receptor (CAR) T cell therapies are under investigation for the treatment of B cell malignancies (4,5).
References
1. Pavlasova G, Mraz M. The regulation and function of CD20: an "enigma" of B-cell biology and targeted therapy. Haematologica. 2020; 105(6):1494-1506. https://doi.org/10.3324/haematol.2019.243543
2. Payandeh Z, Bahrami AA, Hoseinpoor R, et al. The applications of anti-CD20 antibodies to treat various B cells disorders. Biomed Pharmacother. 2019; 109:2415-2426. https://doi.org/10.1016/j.biopha.2018.11.121
3. Margoni M, Preziosa P, Filippi M, Rocca MA. Anti-CD20 therapies for multiple sclerosis: current status and future perspectives. J Neurol. 2022; 269(3):1316-1334. https://doi.org/10.1007/s00415-021-10744-x
4. Klein C, Jamois C, Nielsen T. Anti-CD20 treatment for B-cell malignancies: current status and future directions. Expert Opin Biol Ther. 2021; 21(2):161-181. https://doi.org/10.1080/14712598.2020.1822318
5. Sharman JP. Targeting CD20: teaching an old dog new tricks. Hematology Am Soc Hematol Educ Program. 2019; 2019(1):273-278. https://doi.org/10.1182/hematology.2019000031
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Publications for CD20 Partial Recombinant Protein (H00000931-Q01) (0)
There are no publications for CD20 Partial Recombinant Protein (H00000931-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD20 Partial Recombinant Protein (H00000931-Q01) (0)
There are no reviews for CD20 Partial Recombinant Protein (H00000931-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD20 Partial Recombinant Protein (H00000931-Q01) (0)