CD1c/BDCA-1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CD1c/BDCA-1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD1c/BDCA-1
  
  

  Source: E.coli

  Amino Acid Sequence: NFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CD1C
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24722It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD1c/BDCA-1 Recombinant Protein Antigen

• BDCA1
• BDCA-1
• c polypeptide
• CD1
• CD1A
• CD1c antigen
• CD1c molecule
• CD1c
• cortical thymocyte antigen CD1C
• differentiation antigen CD1-alpha-3
• R7
• T-cell surface glycoprotein CD1c

Background

All CD1 molecules, except CD1e, are cell surface glycoproteins that are structurally related to the MHC molecules, however, in distinction, CD1 proteins are essentially non polymorphic. CD1 has considerable structural homology with both MHC class I and class II molecules, and CD1 molecules are involved in T cell activation. In contrast to MHC, however, CD1 molecules appear to present predominantly non peptide molecules originating from lipids and glycolipids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD1C