CD151 Antibody (1B2) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
CD151 (AAH01374.1, 1 a.a. ~ 253 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGEFNEKKTTCGTVCLKYLLFTYNCCLWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CD151 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
It has been used for ELISA and WB. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CD151 Antibody (1B2)
Background
CD151 is essential for the proper assembly of the glomerular and tubular basement membranes in kidney. It interacts with integrins alpha3beta1, alpha5beta1, alpha3beta1 and alpha6beta4, and with CD9 and CD181. It is expressed in a variety of tissues including vascular endothelium and epidermis, platelets, monocytes and also erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes. CD151 is however not expressed by lymphocytes or granulocytes. Defects in CD151 are the cause of nephropathy with pretibial epidermolysis bullosa and deafness.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Publications for CD151 Antibody (H00000977-M02) (0)
There are no publications for CD151 Antibody (H00000977-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD151 Antibody (H00000977-M02) (0)
There are no reviews for CD151 Antibody (H00000977-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD151 Antibody (H00000977-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD151 Products
Blogs on CD151