CCR2 Recombinant Protein Antigen

Images

 
There are currently no images for CCR2 Recombinant Protein Antigen (NBP3-24720PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CCR2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCR2

Source: E.coli

Amino Acid Sequence: FHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24720It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CCR2 Recombinant Protein Antigen

  • C-C chemokine receptor type 2
  • C-C CKR-2
  • CC-CKR-2
  • CC-CKR-2CKR2B
  • CCR2
  • CCR-2
  • CCR2A
  • CCR2B
  • CD192 antigen
  • CD192
  • chemokine (C-C motif) receptor 2
  • CKR2
  • CKR2A
  • CMKBR2
  • CMKBR2MGC111760
  • FLJ78302
  • MCP-1 receptor
  • MCP-1-R
  • MCP-1-RMGC103828
  • MGC168006
  • Monocyte chemoattractant protein 1 receptor
  • monocyte chemotactic protein 1 receptor

Background

CCR2, or C C chemokine receptor type 2, is a receptor for several monocyte chemo attractant proteins (MCP1, MCP3, MCP4) which specifically mediate monocyte chemotaxis. CCR2 transduces such signals by increasing the intracellular level of calcium ions. For example, MCP1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. CCR2 is also an alternative coreceptor with CD4 for HIV1 infection. CCR2 has two isoforms and has been reported to be expressed in a wide variety of tissues, including blood, brain, heart, kidney, liver, lung, ovary, pancreas, spinal cord, spleen and thymus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCP00
Species: Hu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
MAB145
Species: Hu
Applications: CyTOF-ready, Flow
DRN00B
Species: Hu
Applications: ELISA
MAB155
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
MAB330
Species: Hu
Applications: CyTOF-reported, Flow, IHC, Neut
AF-456-NA
Species: Mu
Applications: Neut, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
350-NS
Species: Fe, Hu, RM
Applications: BA, BA
M6000B
Species: Mu
Applications: ELISA
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
AF5825
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
MAB1567
Species: Hu
Applications: CyTOF-reported, Flow
MAB2005
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-90214
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for CCR2 Recombinant Protein Antigen (NBP3-24720PEP) (0)

There are no publications for CCR2 Recombinant Protein Antigen (NBP3-24720PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCR2 Recombinant Protein Antigen (NBP3-24720PEP) (0)

There are no reviews for CCR2 Recombinant Protein Antigen (NBP3-24720PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CCR2 Recombinant Protein Antigen (NBP3-24720PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCR2 Products

Research Areas for CCR2 Recombinant Protein Antigen (NBP3-24720PEP)

Find related products by research area.

Blogs on CCR2.

Rest in Peace: Is the Receptor Interacting Protein (RIP) Kinase-3 (RIPK3) a Protector or Offender?
By Jamshed Arslan, Pharm. D., PhD. Receptor interacting protein kinases (RIPKs) in necroptosisDeath is perhaps inevitable. Cell death can be programed and immunologically silent (apoptosis), unprogrammed and inflamm...  Read full blog post.

CCR2 or CD192
CCR2 is a receptor for several monocyte chemoattractant proteins (MCP1, MCP3, MCP4) that specifically govern monocyte chemotaxis. CCR2 transduces its downstream signals through increasing intracellular calcium ion levels. For example, MCP1 regulate...  Read full blog post.

CCR2: Affecting Autoimmunity via MCP1 interactions
CCR2, also known as CD192 (cluster of differentiation 192), is a chemokine receptor and is expressed by monocytes, activated T cells, B cells and natural killer cells. This protein is encoded by CCR2 gene in humans. CCR2 gene encodes two protein isofo...  Read full blog post.

MCP1: One Chemoattractant that's Hard to Resist
Monocyte Chemoattractant Protein (MCP1) is a potent monocyte attractant, is a member of the CC chemokine subfamily. MCP1 exerts its effects through binding to G-protein-coupled receptors on the surface of leukocytes targeted for activation and migrati...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CCR2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCR2