| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-42 of Human CCR2 Source: Wheat Germ (in vitro) Amino Acid Sequence: MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
| Preparation Method |
in vitro wheat germ expression system |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | CCR2 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
| Theoretical MW | 30.36 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for CCR2 Partial Recombinant Protein (H00001231-Q01)Find related products by research area.
|
|
Rest in Peace: Is the Receptor Interacting Protein (RIP) Kinase-3 (RIPK3) a Protector or Offender? By Jamshed Arslan, Pharm. D., PhD. Receptor interacting protein kinases (RIPKs) in necroptosisDeath is perhaps inevitable. Cell death can be programed and immunologically silent (apoptosis), unprogrammed and inflamm... Read full blog post. |
|
CCR2 or CD192 CCR2 is a receptor for several monocyte chemoattractant proteins (MCP1, MCP3, MCP4) that specifically govern monocyte chemotaxis. CCR2 transduces its downstream signals through increasing intracellular calcium ion levels. For example, MCP1 regulate... Read full blog post. |
|
CCR2: Affecting Autoimmunity via MCP1 interactions CCR2, also known as CD192 (cluster of differentiation 192), is a chemokine receptor and is expressed by monocytes, activated T cells, B cells and natural killer cells. This protein is encoded by CCR2 gene in humans. CCR2 gene encodes two protein isofo... Read full blog post. |
|
MCP1: One Chemoattractant that's Hard to Resist Monocyte Chemoattractant Protein (MCP1) is a potent monocyte attractant, is a member of the CC chemokine subfamily. MCP1 exerts its effects through binding to G-protein-coupled receptors on the surface of leukocytes targeted for activation and migrati... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.