CCL8/MCP-2 Antibody - BSA Free

Western Blot: CCL8/MCP-2 Antibody [NBP1-79937] - Host: Rabbit. Target: CCL8. Positive control (+): Human Fetal Heart (HE). Negative control (-): HeLa Cell Lysate (HL). Antibody concentration: 1ug/ml

Immunohistochemistry-Paraffin: CCL8/MCP-2 Antibody [NBP1-79937] - Rabbit Anti-CCL8 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adrenal. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec

Western Blot: CCL8/MCP-2 Antibody [NBP1-79937] - Human Heart lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CCL8/MCP-2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human CCL8. Peptide sequence SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CCL8/MCP-2 Antibody - BSA Free

• C-C motif chemokine 8
• CCL8
• chemokine (C-C motif) ligand 8
• HC14
• MCP2
• MCP-2
• member 8 (monocyte chemotactic protein 2)
• monocyte chemoattractant protein 2
• SCYA10
• small-inducible cytokine A8

Background

MCP2 and MCP3 are two recently identified monocyte chemotactic proteins produced by human MG63 osteosarcoma cells. Both MCP2 and MCP3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP1. MCP3 also shares 58% amino acid identity with MCP2. Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCL8/MCP-2 Antibody (NBP1-79937)(1)

Publication using NBP1-79937

• Yang P, Chen W, Xu H Et al. Correlation of CCL8 expression with immune cell infiltration of skin cutaneous melanoma: potential as a prognostic indicator and therapeutic pathway Cancer cell international 2021-11-29 [PMID: 34844613] (IHC-P, Human)

Bioinformatics

• Gene Symbol: CCL8
• Uniprot:
  • NP_005614(Human)