CCL3/MIP-1 alpha Antibody (4E7)

Western Blot: Macrophage Inflammatory Protein 1 alpha Antibody (4E7) [H00006348-M01] - Analysis of CCL3 expression in transfected 293T cell line by CCL3 monoclonal antibody (M01), clone 4E7.Lane 1: CCL3 transfected lysate(10.1 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: Macrophage Inflammatory Protein 1 alpha Antibody (4E7) [H00006348-M01] - Detection limit for recombinant GST tagged CCL3 is approximately 0.1ng/ml as a capture antibody.

Product Discontinued

CCL3/MIP-1 alpha Antibody (4E7) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CCL3 (NP_002974, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
• Specificity: CCL3 - chemokine (C-C motif) ligand 3
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CCL3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL3/MIP-1 alpha Antibody (4E7)

• C-C motif chemokine 3
• MIP1-(a)
• AI323804
• CCL3
• chemokine (C-C motif) ligand 3
• G0S19-1
• LD78a
• LD78alpha
• MIP1 alpha
• MIP-1 alpha
• MIP1A
• MIP-1alpha
• MIP1-alpha
• PAT 464.1
• SCYA3
• SIS-beta

Background

Macrophage inflammatory protein-1 is a so-called monokine that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes (Wolpe et al., 1988 [PubMed 3279154]). Sherry et al. (1988) [PubMed 3058856] demonstrated 2 protein components of MIP1, called by them alpha and beta.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Macrophage Inflammatory Protein 1 alpha Antibody (H00006348-M01)(1)

Publication using H00006348-M01

• Quek SI, Ho ME, Loprieno MA et al. A multiplex assay to measure RNA transcripts of prostate cancer in urine. PLoS One. 2012-09-20 [PMID: 23029164]

Bioinformatics

• Gene Symbol: CCL3
• Entrez:
  • 6348(Human)
• OMIM:
  • 182283(Human)
• Uniprot:
  • NP_002974(Human)