CCL21/6Ckine Recombinant Protein Antigen

Images

 
There are currently no images for CCL21/6Ckine Protein (NBP2-37928PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CCL21/6Ckine Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCL21.

Source: E. coli

Amino Acid Sequence: KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCL21
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37928.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CCL21/6Ckine Recombinant Protein Antigen

  • 6Ckine
  • 6CkineSmall-inducible cytokine A21
  • Beta-chemokine exodus-2
  • CCL21
  • chemokine (C-C motif) ligand 21
  • CKb9
  • exodus-2
  • member 21
  • SCYA21
  • SCYA21MGC34555
  • secondary lymphoid tissue chemokine
  • SLC
  • SLCSecondary lymphoid-tissue chemokine
  • TCA-4

Background

CCL21 is found on the p-arm of chromosome 9 with other CC cytokine genes. As part of the cytokine family of proteins, CCL21 is involved in immunoregulatory and inflammatory processes. CCL21 is also thought to have a role in mediating homing of lymphocytes to secondary lymphoid organs. This protein is known to have interactions with UBQLN4, VCAN, CCR7, CTSD and CCBP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

361-MI
Species: Hu
Applications: BA
MAB197
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
350-NS
Species: Fe, Hu, RM
Applications: BA, BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DM3A00
Species: Hu
Applications: ELISA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
DCP00
Species: Hu
Applications: ELISA
DIP100
Species: Hu
Applications: ELISA
DRN00B
Species: Hu
Applications: ELISA
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
202-IL
Species: Hu
Applications: BA
NBP2-37928PEP
Species: Hu
Applications: AC

Publications for CCL21/6Ckine Protein (NBP2-37928PEP) (0)

There are no publications for CCL21/6Ckine Protein (NBP2-37928PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL21/6Ckine Protein (NBP2-37928PEP) (0)

There are no reviews for CCL21/6Ckine Protein (NBP2-37928PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CCL21/6Ckine Protein (NBP2-37928PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCL21/6Ckine Products

Research Areas for CCL21/6Ckine Protein (NBP2-37928PEP)

Find related products by research area.

Blogs on CCL21/6Ckine.

Meningeal lymphatics: recent discovery defying the concept of central nervous system 'immune privilege'
By Jennifer Sokolowski, MD, PhD. Identification and characterization of meningeal lymphaticsThe recent discovery of a lymphatic system in the meninges surrounding the brain and spinal cord has spurred a surge of int...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CCL21/6Ckine Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL21