CCL18/PARC Antibody (2C6) - Azide and BSA Free

Immunoprecipitation: CCL18/PARC Antibody (2C6) [H00006362-M03] - Analysis of CCL18 transfected lysate using anti-CCL18 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCL18 rabbit polyclonal antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IP
• Clone: 2C6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CCL18/PARC Antibody (2C6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CCL18 (NP_002979, 21 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
• Specificity: CCL18 - chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (2C6)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CCL18
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL18/PARC Antibody (2C6) - Azide and BSA Free

• Alternative macrophage activation-associated CC chemokine 1
• AMAC-1
• AMAC1CC chemokine ligand 18
• AMAC-1Small-inducible cytokine A18
• CCL18
• chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
• CKb7
• DC-CK1
• DC-CK1CC chemokine PARC
• DCCK1Macrophage inflammatory protein 4
• Dendritic cell chemokine 1
• MIP4
• MIP-4
• MIP-4C-C motif chemokine 18
• PARC
• PARCPulmonary and activation-regulated chemokine
• SCYA18chemokine (C-C), dendritic
• small inducible cytokine A18
• small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary andactivation-regulated

Background

This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL18
• Entrez:
  • 6362(Human)
• Uniprot:
  • NP_002979(Human)