CCL18/PARC Antibody (2C6)

Images

 
Immunoprecipitation: CCL18/PARC Antibody (2C6) [H00006362-M03] - Analysis of CCL18 transfected lysate using anti-CCL18 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCL18 rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CCL18/PARC Antibody (2C6) Summary

Immunogen
CCL18 (NP_002979, 21 a.a. - 89 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Specificity
CCL18 - chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (2C6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCL18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL18/PARC Antibody (2C6)

  • Alternative macrophage activation-associated CC chemokine 1
  • AMAC-1
  • AMAC1CC chemokine ligand 18
  • AMAC-1Small-inducible cytokine A18
  • CCL18
  • chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
  • CKb7
  • DC-CK1
  • DC-CK1CC chemokine PARC
  • DCCK1Macrophage inflammatory protein 4
  • Dendritic cell chemokine 1
  • MIP4
  • MIP-4
  • MIP-4C-C motif chemokine 18
  • PARC
  • PARCPulmonary and activation-regulated chemokine
  • SCYA18chemokine (C-C), dendritic
  • small inducible cytokine A18
  • small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary andactivation-regulated

Background

This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00006362-M03
Species: Hu
Applications: WB, ELISA, IP

Publications for CCL18/MIP4 Antibody (H00006362-M03) (0)

There are no publications for CCL18/MIP4 Antibody (H00006362-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL18/MIP4 Antibody (H00006362-M03) (0)

There are no reviews for CCL18/MIP4 Antibody (H00006362-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCL18/MIP4 Antibody (H00006362-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCL18/PARC Products

Bioinformatics Tool for CCL18/MIP4 Antibody (H00006362-M03)

Discover related pathways, diseases and genes to CCL18/MIP4 Antibody (H00006362-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL18/MIP4 Antibody (H00006362-M03)

Discover more about diseases related to CCL18/MIP4 Antibody (H00006362-M03).
 

Pathways for CCL18/MIP4 Antibody (H00006362-M03)

View related products by pathway.

PTMs for CCL18/MIP4 Antibody (H00006362-M03)

Learn more about PTMs related to CCL18/MIP4 Antibody (H00006362-M03).
 

Research Areas for CCL18/MIP4 Antibody (H00006362-M03)

Find related products by research area.

Blogs on CCL18/PARC

There are no specific blogs for CCL18/PARC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL18/PARC Antibody (2C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL18
Entrez
Uniprot