CCL15/MIP-1 delta Antibody (1D7) - Azide and BSA Free

Western Blot: CCL15/MIP-1 delta Antibody (1D7) [H00006359-M01] - Analysis of CCL15 expression in transfected 293T cell line by CCL15 monoclonal antibody (M01), clone 1D7.Lane 1: CCL15 transfected lysate(12.2 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CCL15/MIP-1 delta Antibody (1D7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CCL15 (NP_116741, 25 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
• Specificity: CCL15 (1D7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CCL15
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL15/MIP-1 delta Antibody (1D7) - Azide and BSA Free

• CCL15
• chemokine (C-C motif) ligand 15
• Chemokine CC-2
• HCC-2
• HCC-2Lkn-1
• Leukotactin 1
• Leukotactin-1
• LKN1
• LKN-1
• Macrophage inflammatory protein 5
• MIP1 delta
• MIP-1 delta
• MIP5
• MIP-5
• MIP-5MIP-1d
• Mrp-2b
• NCC-3
• NCC-3MIP-1D
• NCC3MRP-2B
• new CC chemokine 3
• SCYA15member 15
• Small-inducible cytokine A15

Background

This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. This gene expresses both monocistronic and bicistronic transcripts, which encode the same protein. Bicistronic transcripts include the downstream cytokine gene CCL14. Two bicistronic transcripts exist, due to alternate splicing in the CCL14 gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL15
• Entrez:
  • 6359(Human)
• OMIM:
  • 601393(Human)
• Uniprot:
  • NP_116741(Human)