CCL15/MIP-1 delta Antibody (1D7)

Images

 
Western Blot: CCL15/MIP-1 delta Antibody (1D7) [H00006359-M01] - Analysis of CCL15 expression in transfected 293T cell line by CCL15 monoclonal antibody (M01), clone 1D7.Lane 1: CCL15 transfected lysate(12.2 KDa).Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CCL15/MIP-1 delta Antibody (1D7) Summary

Immunogen
CCL15 (NP_116741, 25 a.a. - 113 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Specificity
CCL15 (1D7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCL15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL15/MIP-1 delta Antibody (1D7)

  • CCL15
  • chemokine (C-C motif) ligand 15
  • Chemokine CC-2
  • HCC-2
  • HCC-2Lkn-1
  • Leukotactin 1
  • Leukotactin-1
  • LKN1
  • LKN-1
  • Macrophage inflammatory protein 5
  • MIP1 delta
  • MIP-1 delta
  • MIP5
  • MIP-5
  • MIP-5MIP-1d
  • Mrp-2b
  • NCC-3
  • NCC-3MIP-1D
  • NCC3MRP-2B
  • new CC chemokine 3
  • SCYA15member 15
  • Small-inducible cytokine A15

Background

This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. This gene expresses both monocistronic and bicistronic transcripts, which encode the same protein. Bicistronic transcripts include the downstream cytokine gene CCL14. Two bicistronic transcripts exist, due to alternate splicing in the CCL14 gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB145
Species: Hu
Applications: Flow, CyTOF-ready
MAB328
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
MAB3241
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010488-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF470
Species: Mu
Applications: WB, IHC, Neut
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut

Publications for CCL15/MIP-1 delta Antibody (H00006359-M01) (0)

There are no publications for CCL15/MIP-1 delta Antibody (H00006359-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL15/MIP-1 delta Antibody (H00006359-M01) (0)

There are no reviews for CCL15/MIP-1 delta Antibody (H00006359-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCL15/MIP-1 delta Antibody (H00006359-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCL15/MIP-1 delta Products

Bioinformatics Tool for CCL15/MIP-1 delta Antibody (H00006359-M01)

Discover related pathways, diseases and genes to CCL15/MIP-1 delta Antibody (H00006359-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL15/MIP-1 delta Antibody (H00006359-M01)

Discover more about diseases related to CCL15/MIP-1 delta Antibody (H00006359-M01).
 

Pathways for CCL15/MIP-1 delta Antibody (H00006359-M01)

View related products by pathway.

PTMs for CCL15/MIP-1 delta Antibody (H00006359-M01)

Learn more about PTMs related to CCL15/MIP-1 delta Antibody (H00006359-M01).
 

Research Areas for CCL15/MIP-1 delta Antibody (H00006359-M01)

Find related products by research area.

Blogs on CCL15/MIP-1 delta

There are no specific blogs for CCL15/MIP-1 delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL15/MIP-1 delta Antibody (1D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL15
Entrez
OMIM
Uniprot