CCDC62 Antibody

Images

 
Immunohistochemistry-Paraffin: CCDC62 Antibody [NBP2-32398] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC62 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MERSEISCCQKNEACLGESGMCDSKCCHPSNFIIEAPGHMSDVEWMSIFKPSKMQRIVRLKSGCTCSESICGTQHDSPASELIAIQDSHSLGSSKSALREDETES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC62
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC62 Protein (NBP2-32398PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC62 Antibody

  • coiled-coil domain containing 62
  • FLJ40344
  • testis-specific protein TSP-NY
  • TSP-NY

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-81254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-59678
Species: Hu
Applications: WB
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4736
Species: Hu
Applications: WB
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87001
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2216
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, PAGE
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-39015
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48506
Species: Hu
Applications: WB, IHC
H00005071-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-38121
Species: Hu
Applications: IHC, IHC-P
NBP1-86108
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CCDC62 Antibody (NBP2-32398) (0)

There are no publications for CCDC62 Antibody (NBP2-32398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC62 Antibody (NBP2-32398) (0)

There are no reviews for CCDC62 Antibody (NBP2-32398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC62 Antibody (NBP2-32398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC62 Products

Bioinformatics Tool for CCDC62 Antibody (NBP2-32398)

Discover related pathways, diseases and genes to CCDC62 Antibody (NBP2-32398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC62 Antibody (NBP2-32398)

Discover more about diseases related to CCDC62 Antibody (NBP2-32398).
 

Pathways for CCDC62 Antibody (NBP2-32398)

View related products by pathway.

Blogs on CCDC62

There are no specific blogs for CCDC62, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC62 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC62