![Western Blot: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Western blot analysis of lysates from HeLa cells using CCDC109A Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp2-92310_rabbit-polyclonal-ccdc109a-antibody-42202514275245.jpg%3Ft=1706688241 "Western Blot: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Western blot analysis of lysates from HeLa cells using CCDC109A Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 51-170 of human CCDC109A (NP_612366.1). VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MCU |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CCDC109A Antibody (NBP2-92310)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MCU |
![Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Immunofluorescence analysis of A-549 cells using CCDC109A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92310_rabbit-polyclonal-ccdc109a-antibody-42202514275239.jpg%3Ft=1706688241 "Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Immunofluorescence analysis of A-549 cells using CCDC109A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Immunofluorescence analysis of PC-12 cells using CCDC109A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92310_rabbit-polyclonal-ccdc109a-antibody-4220251429093.jpg%3Ft=1706688241 "Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Immunofluorescence analysis of PC-12 cells using CCDC109A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Immunofluorescence analysis of HeLa cells using CCDC109A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92310_rabbit-polyclonal-ccdc109a-antibody-42202514275246.jpg%3Ft=1706688241 "Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Immunofluorescence analysis of HeLa cells using CCDC109A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Immunofluorescence analysis of NIH/3T3 cells using CCDC109A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92310_rabbit-polyclonal-ccdc109a-antibody-42202514251846.jpg%3Ft=1706688241 "Immunocytochemistry/ Immunofluorescence: CCDC109A Antibody - Azide and BSA Free [NBP2-92310] - Immunofluorescence analysis of NIH/3T3 cells using CCDC109A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")