CC2D1A Antibody

Images

 
Immunohistochemistry-Paraffin: CC2D1A Antibody [NBP1-83666] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CC2D1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CC2D1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CC2D1A Protein (NBP1-83666PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CC2D1A Antibody

  • Akt kinase-interacting protein 1
  • coiled-coil and C2 domain containing 1A
  • coiled-coil and C2 domain-containing protein 1A
  • Five repressor element under dual repression-binding protein 1
  • FLJ20241
  • FLJ41160
  • FRE under dual repression-binding protein 1
  • FREUD-1
  • mental retardation, nonsyndromic, autosomal recessive, 3
  • MRT3Freud-1/Aki1
  • Putative NF-kappa-B-activating protein 023N
  • putative NFkB activating protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-58794
Species: Hu
Applications: WB, ICC/IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-47489
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-03232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF592
Species: Mu
Applications: WB, IHC

Publications for CC2D1A Antibody (NBP1-83666) (0)

There are no publications for CC2D1A Antibody (NBP1-83666).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CC2D1A Antibody (NBP1-83666) (0)

There are no reviews for CC2D1A Antibody (NBP1-83666). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CC2D1A Antibody (NBP1-83666) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CC2D1A Products

Bioinformatics Tool for CC2D1A Antibody (NBP1-83666)

Discover related pathways, diseases and genes to CC2D1A Antibody (NBP1-83666). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CC2D1A Antibody (NBP1-83666)

Discover more about diseases related to CC2D1A Antibody (NBP1-83666).
 

Pathways for CC2D1A Antibody (NBP1-83666)

View related products by pathway.

PTMs for CC2D1A Antibody (NBP1-83666)

Learn more about PTMs related to CC2D1A Antibody (NBP1-83666).
 

Research Areas for CC2D1A Antibody (NBP1-83666)

Find related products by research area.

Blogs on CC2D1A

There are no specific blogs for CC2D1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CC2D1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CC2D1A