CBX3 Recombinant Protein Antigen

Images

 
There are currently no images for CBX3 Protein (NBP1-83228PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CBX3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CBX3.

Source: E. coli

Amino Acid Sequence: RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CBX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83228.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CBX3 Recombinant Protein Antigen

  • chromobox homolog 3 (Drosophila HP1 gamma)
  • chromobox homolog 3
  • chromobox protein homolog 3
  • Drosophila)
  • HECH
  • Heterochromatin protein 1 homolog gamma
  • heterochromatin protein HP1 gamma
  • heterochromatin-like protein 1
  • HP1 gamma homolog
  • HP1 gamma
  • HP1-GAMMA
  • Modifier 2 protein

Background

HP1 gamma appears to be involved in transcriptional silencing in heterochromatin-like complexes. It recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. HP1 gamma may contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR) and involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52420
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC,  IHC-P, WB
DY8198-05
Species: Hu
Applications: ELISA
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-98756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB120-6102
Species: Bv, Ca, Ch, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ICC/IF, IP, KD, KO, WB
NBP1-21367
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
H00008805-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, PLA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45952
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB500-212
Species: Hu
Applications: ICC/IF, IP, KD, WB

Publications for CBX3 Protein (NBP1-83228PEP) (0)

There are no publications for CBX3 Protein (NBP1-83228PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBX3 Protein (NBP1-83228PEP) (0)

There are no reviews for CBX3 Protein (NBP1-83228PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CBX3 Protein (NBP1-83228PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CBX3 Products

Research Areas for CBX3 Protein (NBP1-83228PEP)

Find related products by research area.

Blogs on CBX3

There are no specific blogs for CBX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CBX3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX3