CBX1 Antibody - Azide and BSA Free

Western Blot: CBX1 Antibody [NBP2-92768] - Analysis of extracts of OVCAR-3 cells, using CBX1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CBX1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit CBX1 Antibody - Azide and BSA Free (NBP2-92768) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HP1 beta/CBX1 (NP_006798.1). MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CBX1 Antibody - Azide and BSA Free

• CBXM31HP1-BETA
• chromobox homolog 1 (Drosophila HP1 beta)
• chromobox homolog 1 (HP1 beta homolog Drosophila )
• chromobox homolog 1
• chromobox protein homolog 1
• Heterochromatin protein 1 homolog beta
• heterochromatin protein 1-beta
• heterochromatin protein p25 beta
• Heterochromatin protein p25
• HP1 beta homolog
• HP1 beta
• HP1Hsbeta
• HP1Hs-beta
• MOD1
• Modifier 1 protein
• p25beta

Background

HP1 gamma appears to be involved in transcriptional silencing in heterochromatin-like complexes. It recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. HP1 gamma may contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR) and involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CBX1