Cbx2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cbx2 Antibody [NBP2-47524] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Cbx2 Antibody [NBP2-47524] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cbx2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cbx2 Protein (NBP2-47524PEP)
Publications
Read Publication using NBP2-47524.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cbx2 Antibody

  • Cbx2
  • CDCA6
  • cell division cycle associated 6
  • chromobox homolog 2 (Drosophila Pc class)
  • chromobox homolog 2 (Pc class homolog, Drosophila)
  • chromobox homolog 2
  • chromobox protein homolog 2
  • M33
  • MGC10561
  • modifier 3
  • Pc class homolog
  • SRXY5

Background

Polycomb' genes in Drosophila maintain the repressed state of homeotic and other developmentally regulatedgenes (Wedeen et al., 1986 (PubMed 3081265); Kuziora and McGinnis, 1988 (PubMed 2903050)) by mediating changes inhigher-order chromatin structure (Paro and Hogness, 1991 (PubMed 1898775)). M33, a mouse homolog of polycomb, wasisolated by means of the structural similarity of its chromodomain (Pearce et al., 1992 (PubMed 1352241)). The fifthexon of M33 contains a region of homology shared by Drosophila and Xenopus. In Drosophila, its deletion results in theloss of polycomb function.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cbx2 Antibody (NBP2-47524)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for Cbx2 Antibody (NBP2-47524) (0)

There are no reviews for Cbx2 Antibody (NBP2-47524). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cbx2 Antibody (NBP2-47524) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cbx2 Products

Research Areas for Cbx2 Antibody (NBP2-47524)

Find related products by research area.

Blogs on Cbx2

There are no specific blogs for Cbx2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cbx2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX2