CBS Antibody

Images

 
Western Blot: CBS Antibody [NBP1-52850] - HepG2 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml lysate Quantity: 25ug/ Lane/ ...read more
Immunohistochemistry-Paraffin: CBS Antibody [NBP1-52850] - Human Kidney tissue, Epithelial cells of renal tubule (Indicated with Arrows) 4-8 ug/ml.
Western Blot: CBS Antibody [NBP1-52850] - Human kidney lysate, concentration 4-8ug/ml.
Western Blot: CBS Antibody [NBP1-52850] - HepG2 cell lysate, concentration 1.25 ug/ml.
Western Blot: CBS Antibody [NBP1-52850] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate ...read more
Immunohistochemistry-Paraffin: CBS Antibody [NBP1-52850] - Mouse Brain tissue, 4-8ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBS Antibody Summary

Immunogen
Synthetic peptides corresponding to CBS(cystathionine-beta-synthase) The peptide sequence was selected from the N terminal of CBS. Peptide sequence RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CBS and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CBS Antibody

  • cystathionine-beta-synthase
  • EC 4.2.1.2210Beta-thionase

Background

CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for CBS Antibody (NBP1-52850) (0)

There are no publications for CBS Antibody (NBP1-52850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBS Antibody (NBP1-52850) (0)

There are no reviews for CBS Antibody (NBP1-52850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBS Antibody (NBP1-52850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBS Products

Bioinformatics Tool for CBS Antibody (NBP1-52850)

Discover related pathways, diseases and genes to CBS Antibody (NBP1-52850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBS Antibody (NBP1-52850)

Discover more about diseases related to CBS Antibody (NBP1-52850).
 

Pathways for CBS Antibody (NBP1-52850)

View related products by pathway.

PTMs for CBS Antibody (NBP1-52850)

Learn more about PTMs related to CBS Antibody (NBP1-52850).
 

Research Areas for CBS Antibody (NBP1-52850)

Find related products by research area.

Blogs on CBS

There are no specific blogs for CBS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBS
Uniprot