CBS Antibody (1R2E9)

Western Blot: CBS Antibody (1R2E9) [NBP3-15413] - Western blot analysis of extracts of various cell lines, using CBS Rabbit mAb (NBP3-15413) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: CBS Antibody (1R2E9) [NBP3-15413] - Immunofluorescence analysis of HeLa cells using CBS Rabbit mAb (NBP3-15413) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: CBS Antibody (1R2E9) [NBP3-15413] - Immunohistochemistry of paraffin-embedded human thyroid cancer using CBS Rabbit mAb (NBP3-15413) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: CBS Antibody (1R2E9) [NBP3-15413] - Western blot analysis of extracts of various cell lines, using CBS Rabbit mAb (NBP3-15413) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin: CBS Antibody (1R2E9) [NBP3-15413] - Immunohistochemistry of paraffin-embedded rat lung using CBS Rabbit mAb (NBP3-15413) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using CBS Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using CBS Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using CBS Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using CBS Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 1R2E9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CBS Antibody (1R2E9) Summary

• Description: Novus Biologicals Rabbit CBS Antibody (1R2E9) (NBP3-15413) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-551 of human CBS (P35520). EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CBS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CBS Antibody (1R2E9)

• cystathionine-beta-synthase
• EC 4.2.1.2210Beta-thionase

Background

CBS is encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CBS