CBR4 Antibody - BSA Free

Western Blot: CBR4 Antibody [NBP1-82235] - Analysis in control (vector only transfected HEK293T lysate) and CBR4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: CBR4 Antibody [NBP1-82235] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CBR4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CBR4 Antibody - BSA Free (NBP1-82235) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBR4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CBR4 Protein (NBP1-82235PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CBR4 Antibody - BSA Free

• 3-oxoacyl-[acyl-carrier-protein] reductase
• carbonic reductase 4
• carbonyl reductase 4
• carbonyl reductase family member 4
• EC 1.1.1
• EC 1.1.1.-
• EC 1.1.1.100
• FLJ14431
• Quinone reductase CBR4
• SDR45C1
• short chain dehydrogenase/reductase family 45C, member 1

Background

The heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. Mayplay a role in biosynthesis of fatty acids in mitochondria. The homotetramer may act as NADPH-dependent quinonereductase. Has broad substrate specificity and reduces 9,10-phenanthrenequinone, 1,4-benzoquinone and various othero-quinones and p-quinones (in vitro)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CBR4