CBR1 Antibody


Western Blot: CBR1 Antibody [NBP1-52872] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CBR1 Antibody Summary

Synthetic peptides corresponding to CBR1(carbonyl reductase 1) The peptide sequence was selected from the C terminal of CBR1 (NP_001748). Peptide sequence PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.25 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CBR1 and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CBR1 Antibody

  • 15-hydroxyprostaglandin dehydrogenase [NADP+]
  • carbonyl reductase (NADPH) 1
  • carbonyl reductase (NADPH) 1, EC,15-hydroxyprostaglandin dehydrogenase
  • carbonyl reductase [NADPH] 1
  • carbonyl reductase 1
  • CBR
  • CRN
  • EC
  • EC
  • hCBR1
  • NADPH-dependent carbonyl reductase 1
  • Prostaglandin 9-ketoreductase
  • Prostaglandin-E(2) 9-reductase
  • SDR21C1
  • short chain dehydrogenase/reductase family 21C, member 1


Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
Species: Hu
Applications: WB, IP
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CBR1 Antibody (NBP1-52872) (0)

There are no publications for CBR1 Antibody (NBP1-52872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBR1 Antibody (NBP1-52872) (0)

There are no reviews for CBR1 Antibody (NBP1-52872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBR1 Antibody (NBP1-52872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CBR1 Products

Bioinformatics Tool for CBR1 Antibody (NBP1-52872)

Discover related pathways, diseases and genes to CBR1 Antibody (NBP1-52872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBR1 Antibody (NBP1-52872)

Discover more about diseases related to CBR1 Antibody (NBP1-52872).

Pathways for CBR1 Antibody (NBP1-52872)

View related products by pathway.

PTMs for CBR1 Antibody (NBP1-52872)

Learn more about PTMs related to CBR1 Antibody (NBP1-52872).

Research Areas for CBR1 Antibody (NBP1-52872)

Find related products by research area.

Blogs on CBR1

There are no specific blogs for CBR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CBR1 Antibody and receive a gift card or discount.


Gene Symbol CBR1