CBLB Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CBLB Antibody [NBP1-86599] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CBLB Antibody [NBP1-86599] - Staining of human stomach shows strong positivity in Parietal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBLB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBLB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBLB Protein (NBP1-86599PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBLB Antibody

  • Cas-Br-M (murine) ecotropic retroviral transforming sequence b
  • Cas-Br-M (murine) ectropic retroviral transforming sequence b
  • Casitas B-lineage lymphoma proto-oncogene b
  • DKFZp686J10223
  • DKFZp779A0729
  • DKFZp779F1443
  • E3 ubiquitin-protein ligase CBL-B
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ41152
  • RING finger protein 56
  • RNF56FLJ36865
  • SH3-binding protein CBL-B
  • Signal transduction protein CBL-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB342
Species: Hu
Applications: WB, AgAct
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-78063
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-46403
Species: Hu
Applications: IHC

Publications for CBLB Antibody (NBP1-86599) (0)

There are no publications for CBLB Antibody (NBP1-86599).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBLB Antibody (NBP1-86599) (0)

There are no reviews for CBLB Antibody (NBP1-86599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CBLB Antibody (NBP1-86599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBLB Products

Bioinformatics Tool for CBLB Antibody (NBP1-86599)

Discover related pathways, diseases and genes to CBLB Antibody (NBP1-86599). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBLB Antibody (NBP1-86599)

Discover more about diseases related to CBLB Antibody (NBP1-86599).
 

Pathways for CBLB Antibody (NBP1-86599)

View related products by pathway.

PTMs for CBLB Antibody (NBP1-86599)

Learn more about PTMs related to CBLB Antibody (NBP1-86599).
 

Research Areas for CBLB Antibody (NBP1-86599)

Find related products by research area.

Blogs on CBLB

There are no specific blogs for CBLB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBLB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBLB