Recombinant Human Cathepsin K Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cathepsin K Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human CTSK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Protein/Peptide Type
Partial Recombinant Protein
Gene
CTSK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cathepsin K Protein

  • cathepsin K (pycnodysostosis)
  • Cathepsin K
  • Cathepsin O
  • cathepsin O1
  • Cathepsin O2
  • Cathepsin X
  • CTS02
  • CTSK
  • CTSO
  • CTSO1
  • CTSO2
  • EC 3.4.22
  • EC 3.4.22.38
  • MGC23107
  • PKND
  • PYCD

Background

CTSK - cathepsin K (pycnodysostosis)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00001513-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cathepsin K Partial Recombinant Protein (H00001513-Q01) (0)

There are no publications for Cathepsin K Partial Recombinant Protein (H00001513-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin K Partial Recombinant Protein (H00001513-Q01) (0)

There are no reviews for Cathepsin K Partial Recombinant Protein (H00001513-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin K Partial Recombinant Protein (H00001513-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cathepsin K Products

Bioinformatics Tool for Cathepsin K Partial Recombinant Protein (H00001513-Q01)

Discover related pathways, diseases and genes to Cathepsin K Partial Recombinant Protein (H00001513-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin K Partial Recombinant Protein (H00001513-Q01)

Discover more about diseases related to Cathepsin K Partial Recombinant Protein (H00001513-Q01).
 

Pathways for Cathepsin K Partial Recombinant Protein (H00001513-Q01)

View related products by pathway.

PTMs for Cathepsin K Partial Recombinant Protein (H00001513-Q01)

Learn more about PTMs related to Cathepsin K Partial Recombinant Protein (H00001513-Q01).
 

Research Areas for Cathepsin K Partial Recombinant Protein (H00001513-Q01)

Find related products by research area.

Blogs on Cathepsin K

There are no specific blogs for Cathepsin K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cathepsin K Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSK
Entrez