Cathepsin B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cathepsin B Antibody [NBP1-86048] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & vesicles.
Immunohistochemistry-Paraffin: Cathepsin B Antibody [NBP1-86048] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Cathepsin B Antibody [NBP1-86048] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Cathepsin B Antibody [NBP1-86048] - Staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Cathepsin B Antibody [NBP1-86048] - Staining of human breast cancer shows moderate cytoplasmic positivity in tumor cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cathepsin B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTSB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
Cathepsin B Protein (NBP1-86048PEP)
Publications
Read Publications using NBP1-86048.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22918166)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cathepsin B Antibody

  • APP secretase
  • APPS
  • Cathepsin B
  • Cathepsin B1
  • CPSBamyloid precursor protein secretase
  • CTSB
  • cysteine protease
  • EC 3.4.22
  • EC 3.4.22.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1029
Species: Mu
Applications: WB, IHC, IP
AF1013
Species: Mu
Applications: WB, IHC, IP
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1310
Species: Hu
Applications: WB, IHC, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Cathepsin B Antibody (NBP1-86048)(2)

Reviews for Cathepsin B Antibody (NBP1-86048) (0)

There are no reviews for Cathepsin B Antibody (NBP1-86048). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cathepsin B Antibody (NBP1-86048) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin B Products

Bioinformatics Tool for Cathepsin B Antibody (NBP1-86048)

Discover related pathways, diseases and genes to Cathepsin B Antibody (NBP1-86048). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin B Antibody (NBP1-86048)

Discover more about diseases related to Cathepsin B Antibody (NBP1-86048).
 

Pathways for Cathepsin B Antibody (NBP1-86048)

View related products by pathway.

PTMs for Cathepsin B Antibody (NBP1-86048)

Learn more about PTMs related to Cathepsin B Antibody (NBP1-86048).
 

Research Areas for Cathepsin B Antibody (NBP1-86048)

Find related products by research area.

Blogs on Cathepsin B.

Cathepsin B - a lysosomal protease with potential of an important drug target in neurological diseases and cancer
Cathepsins are a family of lysosomal proteases (serine, aspartic and cysteine proteases) that acts in conjunction with lipases and nucleases to degrade biological macromolecules in the lysosomes (1). While most cathepsins are ubiquitously expressed...  Read full blog post.

Caspase 11: A novel non-canonical inflammasomes
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands. This regulated process then transmits downstream signals through adaptor molecules ending with the caspase cysteine proteases. Caspas...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSB
Entrez