Catenin alpha 1 Antibody (9O1V3)

Western Blot: Catenin alpha 1 Antibody (9O1V3) [NBP3-15613] - Western blot analysis of extracts of various cell lines, using Catenin alpha 1 antibody (NBP3-15613) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Catenin alpha 1 Antibody (9O1V3) [NBP3-15613] - Western blot analysis of extracts from normal (control) and Catenin alpha 1 knockout (KO) 293T cells, using Catenin alpha 1 antibody (NBP3-15613) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, KO
• Clone: 9O1V3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Catenin alpha 1 Antibody (9O1V3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Catenin alpha 1 (P35221). MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQ
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CTNNA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockout Validated
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Catenin alpha 1 Antibody (9O1V3)

• Alpha E-catenin
• alpha-catenin
• alpha-E-catenin
• alphaE-catenin
• cadherin-associated protein
• CAP102
• catenin (cadherin-associated protein), alpha 1 (102kD)
• catenin (cadherin-associated protein), alpha 1, 102kDa
• catenin alpha-1
• FLJ36832
• FLJ52416
• Renal carcinoma antigen NY-REN-13

Background

Cadherin and catenin compose cell adhesion complex and are indispensable for tight cell-cell adhesion. Dysfunction of this adhesion complex causes dissociation of cancer cells from primary tumor nodules, thus possibly contributing to cancer invasion and metastasis (1). At least three proteins (alpha, beta, and gamma catenin) comprise the cytoplasmic domain of the cadherin cell-cell adhesion complex. Data, with the reported structure of other catenin genes, suggest that vinculin and alpha-catenin generate a superfamily of proteins mediating membrane-cytoskeletal associations (2). Presenilin-1 (PS1) overexpression in human kidney cells enhances cell-cell adhesion and data show that PS1 incorporates into the cadherin/catenin adhesion system and regulates cell-cell adhesion. PS1 concentrates at intercellular contacts in epithelial tissue; in brain, it forms complexes with both E- and N-cadherin and concentrates at synaptic adhesions (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTNNA1